SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293077 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293077
Domain Number 1 Region: 12-218
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.21e-33
Family AlkB-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293077   Gene: FBgn0032259   Transcript: FBtr0304137
Sequence length 228
Comment pep:known chromosome:BDGP5:2L:10488892:10490461:1 gene:FBgn0032259 transcript:FBtr0304137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFTGFEVRKCPPTVMYIPNFITSEEEQRILSHIERTPKPRWTQLLNRRLVNYGGVPHPN
GMIAEEIPEWLQTYVDKVNNLGVFESQNANHVLVNEYLPGQGILPHTDGPLFHPIISTIS
TGAHTVLEFVKREDTTTETEAGDQTTREVLFKLLLEPRSLLILKDTLYTDYLHAISETSE
DVLCDRISNYDLCENTYKIGDHLVRRSPRISLTIRNVPKTSKMKLKFC
Download sequence
Identical sequences Q9VKU5
7227.FBpp0100020 FBpp0100020 FBpp0293077 FBpp0100020 FBpp0100020 FBpp0293077 NP_001033895.1.81976 NP_609414.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]