SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293081 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293081
Domain Number 1 Region: 763-1030
Classification Level Classification E-value
Superfamily NHL repeat 7.19e-35
Family NHL repeat 0.0000000000742
Further Details:      
 
Domain Number 2 Region: 322-361
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000229
Family B-box zinc-binding domain 0.0059
Further Details:      
 
Weak hits

Sequence:  FBpp0293081
Domain Number - Region: 632-819
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0384
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293081   Gene: FBgn0010300   Transcript: FBtr0304151
Sequence length 1056
Comment pep:known chromosome:BDGP5:2L:19133816:19179758:1 gene:FBgn0010300 transcript:FBtr0304151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPTPSLDSMRGGANSIESYEHAGYLSDSPLTLSGSSPPASDSAICSDEYTGGSSVKS
RSEVTVINGHHPISASVSSSSSASSSSCSSSSSSSSSSSSSSSSTSGLSGCGSTSSSVIS
ANNVASSNGPGVIGSNLQSSNNGGNSGISSLVVGAGKGSNSSSNSSSSNTSANGSPPRCT
ACKSKCSDAVAKCFECQSYLCANCVTAHEFMHCFNGHNVCLIKGFEASTTGTPLSVGSPS
NNPASNEFKYASSLTMMLQQQQQLDSQQQQQQQQLLPAQPMSQLSKIVLAAAAQANSQEQ
QREDSIYGSLHPQQQQQQQQQQQRQLFCPRHKQELLKFSCRTCCILVCKECIVLEHSTGL
HELENVQSPGMTTSTGSTANESALQTLLADMRGKIGEIVGIAGNSDQNLTKVKLQYQKAH
NELNETHQFFASMLDERKTELLKELETLYTAKVNSNNSWQQRSRDLIDKGLATCEAVERS
PAPPSSLLTEALLLRKSLEQQLQTGIQEMQLPFEIEFMSNYQSIQAGVRNTFGYIRANSS
DGGPTGMSLTSNGHGKQPPIARPTQSASNSSASSAGSGHHGHHQQSHHHGHHNHHQTAHH
QQLQAQSSLHGLGLGLSGASLLDSSSSAGGAVGAFSNGGLLLGGRDRNALAVEQHFGELM
PKRGGGGYTGSNGSATSAVAHYNPYEKWSNGGSDNLFSSVTSGVSGSSAVADAFASLSAV
GGSVVSGAGAGGSTVSSESLLDLTNKLLSATIYPPKSQIKRQKMIYHCKFGEFGVMEGQF
TEPSGVAVNAQNDIIVADTNNHRIQIFDKEGRFKFQFGECGKRDSQLLYPNRVAVVRNSG
DIIVTERSPTHQIQIYNQYGQFVRKFGATILQHPRGVTVDNKGRIIVVECKVMRVIIFDQ
NGNVLHKFGCSKHLEFPNGVVVNDKQEIFISDNRAHCVKVFNYEGQYLRQIGGEGITNYP
IGVGINSNGEILIADNHNNFNLTIFTQDGQLISALESKVKHAQCFDVALMDDGSVVLASK
DYRLYIYRYVQLAPVVSTVEPHTKNSHRQESTLLNH
Download sequence
Identical sequences FBpp0293081 FBpp0293081 FBpp0080703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]