SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293179 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293179
Domain Number 1 Region: 33-171
Classification Level Classification E-value
Superfamily C-type lectin-like 1.55e-28
Family C-type lectin domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293179   Gene: FBgn0262357   Transcript: FBtr0304637
Sequence length 180
Comment pep:known chromosome:BDGP5:2L:4411155:4411824:1 gene:FBgn0262357 transcript:FBtr0304637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTKLTAFSAFLAIISLCRAYQISTSVIEGVASYLNTPTAPFVKIGDSYYFIENKLDRNW
YDAFEACRQMNADLVAFEDRKEQKLIYHYLVDNEMDTTYWTAGTDLAEQDSFVWFSNGQP
VASDLWCNNEPNNAKNEEHCVEYKPLHPEAKMGLNDRVCTFKTGYICRAPQPKTVSFIVW
Download sequence
Identical sequences M9NE79
NP_001245867.1.81976 FBpp0293179 FBpp0293179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]