SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293183 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293183
Domain Number 1 Region: 39-99
Classification Level Classification E-value
Superfamily RING/U-box 5.82e-17
Family RING finger domain, C3HC4 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293183   Gene: FBgn0262360   Transcript: FBtr0304641
Sequence length 100
Comment pep:known chromosome:BDGP5:2R:9488215:9488517:-1 gene:FBgn0262360 transcript:FBtr0304641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQMQCHCRACRHNVPNEIIDLCSPQKQPVKRLRSDLGDSDEPYMCPICMENVRRRQPA
ATPCGHVFCYDCIQKAIGDYKKCPMCNKKIMYKQLTRIFL
Download sequence
Identical sequences A0A0B4K780
FBpp0293183 NP_001246302.1.81976 FBpp0293183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]