SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293250 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293250
Domain Number 1 Region: 89-135
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000541
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 27-84
Classification Level Classification E-value
Superfamily RING/U-box 0.0000035
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293250   Gene: FBgn0037885   Transcript: FBtr0304707
Sequence length 137
Comment pep:known chromosome:BDGP5:3R:7061105:7061799:1 gene:FBgn0037885 transcript:FBtr0304707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYVNLIIGLGLVSVAAFAYFNWHNDRSSPYSRSPNGRCTFCQYELSDDDRRRMRCGHAM
HNLCYLVFRYSHRKCLECDKVVNVNIAGDLCTICLDPLSVYTMVYLRCSHALHEKCLHQY
QANGGRHCPVCRMGIKE
Download sequence
Identical sequences Q9VGQ7
FBpp0081830 FBpp0081830 FBpp0293250 NP_001247040.1.81976 NP_650059.1.81976 7227.FBpp0081830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]