SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293251 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293251
Domain Number 1 Region: 100-147
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000464
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 35-96
Classification Level Classification E-value
Superfamily RING/U-box 0.00000314
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293251   Gene: FBgn0037885   Transcript: FBtr0304708
Sequence length 149
Comment pep:known chromosome:BDGP5:3R:7061105:7061799:1 gene:FBgn0037885 transcript:FBtr0304708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYVNLIIGLGLVSVAAFAYFNWHNDRSSPYSRWVLLNERRIVGRSPNGRCTFCQYELSD
DDRRRMRCGHAMHNLCYLVFRYSHRKCLECDKVVNVNIAGDLCTICLDPLSVYTMVYLRC
SHALHEKCLHQYQANGGRHCPVCRMGIKE
Download sequence
Identical sequences A0A0B4K658
NP_001247041.1.81976 FBpp0293251 FBpp0293250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]