SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293286 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293286
Domain Number 1 Region: 1274-1383
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.06e-22
Family Elongation factor TFIIS domain 2 0.0061
Further Details:      
 
Domain Number 2 Region: 900-967
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.08e-18
Family PHD domain 0.00031
Further Details:      
 
Domain Number 3 Region: 1139-1198
Classification Level Classification E-value
Superfamily BRK domain-like 0.00000000000000837
Family BRK domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293286   Gene: FBgn0082831   Transcript: FBtr0304744
Sequence length 2018
Comment pep:known chromosome:BDGP5:3R:8239558:8246973:1 gene:FBgn0082831 transcript:FBtr0304744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVFTEAPSARPAAAEADSNLVVVYSKSGISFDERAIGNIMEEKSISTISVVRITSPT
PSMVDQEEDERLEELANFMETATDSELDSDNGSQSGGDNASEMDEHDEENHNTGDDNNSD
STETEADAPRTRKRVGRKPKAIKKRKRRKPKERPQIVGLRVEQFYADNTADMVVKNALKL
AGVSVYKRTAETDALMEVIRNDHNYTPFTSPEQLKNHKRDEKMAMEMQAQSRKIIMQAPG
SVKLINAKKRVQAIPLSPVQVKVQRLPVKPHQVQQAAQLQPKVQLIRKPIHSPLPRQKPE
IIANNSVNARLRPTRAPVKVIAPPVQEYIEDDDDAQSSDSAEEENADKAYDSEEMSEESD
EFQESDNDRDSDMDFDMRHSNRRNPNKRKRVRKVVRQTPSKPMKPLPPPPTTPQHFPELK
KRKEVLEPKAPQIGQIIQMPATKSVPAVFALGRGLPSTSFLKIRPTHQSLPVKRPPLPTT
PANSNVRRMPAVQLGRIVNSPQEVKEIIINKNMASPKGVFTNLNTLLGEDNNAATKSSPV
PLRHRAVMSPSTPRSSYNQQMSPIVVPVPAQAHTPSKGFMPIGVDTAQSHKLPAQIVIET
HQSSSELAAENDKQLDLINSIVQDELLKSTLVEQPVVNADEDIPKLVKMLESTAADLDPP
PVSLPTNIFPAPEMQGVGNAAAADPNNIMDTANEDEITADFLQHVVGLIEEDKQFEAEVV
KQVLASTEPGTLDAIVSMPTSIEPVDVPQVQAHTNLLPNASLTEPAQSMTSLPIACSTPS
RSVAASTPPTSAKVVRGYGRVIYLPPIEAPTTRAKRRAQFPSAPGMAATSSSDAGNLSFG
ESSLDASINQPLNTSSLSNDSQPGSGPKRPNPREPSMARRSTAPRRSKKLDASQNNDPDA
SESQEDDDDPNKLWCICRQPHNNRFMICCDLCEDWFHGTCVGVTKAMGTDMENKGIDWKC
PKCVKRQEERSQPRITDMLVTRPTTQPEQRPSETKVLTTTAEIVQVAAPSAPRRTLPVVL
TVASSPMRIPMAKPAKKFPTGAISHQQQQQLNFIRLGPSPGKRISETLCVVCKRPASTSS
VYCGEECIRKYAQSAIQAHAATKGPLPQNAGAQSLLNNSFDAKKNKKKDLFEDVLRQADT
VSKVERINVFERKSGRVITGHMAPSAHQFRKWLQENPSFEVLPSGTVQSADAEKRLLKGA
PEAATSTSEPAVLGVAKKPPEGPAKLSHPQNTTVQASHQLGISSVRPLAKKDKEKTTPTV
QAPTPNRIAAGKPEPVRIGIRRSLREQLLARIKEAQAAEENSGQPTTQWPTVLEVDQFVK
NVELEMFNSFGRDVGAKYKAKYRSLMFNIKDRKNRTLFEKICAKQVEPRQLVRMTPEQLA
SQELAKWREEENRHQLDMIKKSELDLLACAQNYVVKTHKGEEVIATKVDVTLPEENVSEA
SSMADTKQTSLVSEPSTSTLERSTSREKAGSSKEKRHKSHKHHHRKRSRSRSNSRGRSVD
KRHRRQHNEGGEQPGSGEREHRSREKQSRERDEIVPSPLPKKRDENDQSPVPKKTAEKKT
EASAYNLVDQILESEKTVEQAANLGKPKPSPKPLPTLPSSLKAPEPMDNYSRYLHGLTTS
SLWSGTLKMIDLADFEIVMYPVQGNCHQLGNLMPSQMDVIGRITRVNVWEYIKKLKKSPT
KEVVIVNIFPASPSETYKFDLFFEYLDSRQRLGVLGVDSDQIRDFYIFPLGSGDKLPPAL
QTAEPVPFYEEAQRPNTLLGIIVRCLSKRPADAVPSTPSVPTPVPALSSKVAKRSRSSIS
YPAQSSPKRKISTHSTSSKDDEFDIDAIIKAPIAKLQKTAPKVVPQPSVPNDADEPYSPG
GSDDELVPSAPQRPNDLERQVNEINKQIAAQQMEIAGLLKVEPTGSASSSNVLAAISIPA
NLSKILASIKDKTNLPSSADDGDEEYNPEDDITATSSFASKKPRSKGRLAHLSEAELLSM
VPDNLAGVIPRSSRTRHQLAQSPLTPTPLPPPPPPPGV
Download sequence
Identical sequences A0A0B4K6G3
FBpp0293286 NP_001247075.1.81976 FBpp0293286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]