SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293292 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293292
Domain Number 1 Region: 79-423
Classification Level Classification E-value
Superfamily L domain-like 2.55e-55
Family Internalin LRR domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293292   Gene: FBgn0033250   Transcript: FBtr0304750
Sequence length 498
Comment pep:known chromosome:BDGP5:2R:3896624:3901259:-1 gene:FBgn0033250 transcript:FBtr0304750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIQLQSGCTMVVTVVLLLQVLVMDQVLGQGPPQTQVCPEQSEIAPCICTVKKNGLDIL
CETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIE
ENALSSLGAGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLE
ILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRT
ISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEEN
LQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDI
KVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELTWFPK
LLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHCAGLNVSPSPTSGGLMRILQ
VNILAQIAVCSVAFLTSV
Download sequence
Identical sequences D0Z756
FBpp0293292 FBpp0293292 NP_001246198.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]