SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293345 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293345
Domain Number 1 Region: 132-190
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000201
Family B-box zinc-binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 6-90
Classification Level Classification E-value
Superfamily RING/U-box 0.00000113
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293345   Gene: FBgn0039347   Transcript: FBtr0304805
Sequence length 508
Comment pep:known chromosome:BDGP5:3R:21444136:21446401:1 gene:FBgn0039347 transcript:FBtr0304805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESIQVPKELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQRNTDHNSSECICNL
CGYRTQLDGQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNW
VEDINVESFLATSAEHCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQVDYHDLI
SQLLNSELRKIKSTAVHAKELATHEMDLLRELCEACYRVQLHVKREMLEHHSSMVAASMI
GWHRLAERDLHRVGRLTGAKMLQVLAHLATQRQRYERQLDQVHFQCRMQAAIQENGMQVL
DFETLNNRIARLRSHRRPGAIPANVGPPQALILTNYCVYAYWCEMQREMIPPRHRNLTPD
PELLPEPRRAVVPPHFNNSLREVELLDYVQQIELEQFRTLSQPPYDGSHESSSSPNSSSS
TNSQSNYIALDTEYGLRELVRQLQQQPQQVQQEQQQQQQQVHQLTHSIYQPDAILVNSVE
PQLIGQQSHDHHRQDGGTSSSENWPDGS
Download sequence
Identical sequences A0A0B4K7U6
NP_001247305.1.81976 FBpp0293345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]