SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293373 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293373
Domain Number 1 Region: 663-712,758-765,811-869
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 370-463
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-16
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 275-377
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000296
Family C1 set domains (antibody constant domain-like) 0.045
Further Details:      
 
Domain Number 4 Region: 173-259
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000427
Family C1 set domains (antibody constant domain-like) 0.053
Further Details:      
 
Domain Number 5 Region: 48-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000451
Family V set domains (antibody variable domain-like) 0.078
Further Details:      
 
Domain Number 6 Region: 589-672
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000145
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 492-580
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000244
Family I set domains 0.055
Further Details:      
 
Domain Number 8 Region: 845-950
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000281
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293373   Gene: FBgn0262509   Transcript: FBtr0304833
Sequence length 2192
Comment pep:known chromosome:BDGP5:3L:22991472:23031377:1 gene:FBgn0262509 transcript:FBtr0304833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNMALRQSAKDVAKSNCVAVRSSISLSLVLVLCLALVDSSTAQVDTTISQQESQSVVLP
CPVDAEKCGKLHSLNWFKGDDRIAAMLLGDSNVTSVNKEFDERVTVEQNPYRLVIKDLKI
ADEDIYLCDTTFFIPEETCDNFNGYRIELRVLVPPTEVVILDAKGDRIKNGSVVGPMQER
QSLKATCTVRNTRPQPEVSWFRGTKRLTTYSPTHDLVDGLYTSTLELDWTLSREDLAQDI
ECRVKSAAIQNVTVTKFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHGARPAVNLTW
YNTTTIISSGENEITEVRSKSLEKSDGTFHTQSELIFNATRFENDRVFRCEAENIVLQIN
REKPISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFANPASLTQVEWYRNDILVN
VNDTTHYKGGNSENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVEIL
MIPEGPVKESDESNVTLFCNVLDANPSVLTKVRWYANSTLLKELPDCEETREDLCHIDPS
KLLLESIGRGFFYNYSCEGFNAAGWGPRSEDKELLVHYEPGPAALSHFPLVAVKKKSVTF
SCSVDDPGFPESNRFRWLRGGRGPLQDIVTKDWTVEPVGLDSRTNYSCYAYNEGGKGVMA
TVNLEVHAPPFFIKNLPPYTGILHSSPNATLTCRIECVPRCDISWQKDGVPIERNDSRYF
IKEKYMDASPATGDFESMLSVLHFNMPNWPDSKFNIEADNANYSCVSTGNIVGGSIRSRT
YFGIEYAPENTTVSENIVYVQEDTIPGRVICKSRANPEPSYKWIFKNETIANGNALIINT
AMNRNDDGTYTCLAYNKHGSSIAKTVIKVQFKPRCEIERQEIDDQDTLICTAYGNPIEAD
FSWSIKTENETDENLGSGKKENSVEKSFYILQTDYAISRTYRCVANNTVGYGPFCEIEVA
EQLAWWQLWEKNTLIILVAAILGLLLTVIVICCIIICICRRRRRQDKYLTEVPINSIQSA
LSDQLDMSRAGRNLSTQDKCTAILPNPSSSRFIGSAPKSPPRWPIRPGVMLHVSSNTKEN
LTVNRMTVKPNVSGNRGDMSQLSAQLSAALNGSRDNSDGTILTEISAVSGENEASNLSIL
EVTNRKKATVPSTIRNVSTAEGEIISSKTHSAGHIALDHVWSLIFKKSDDRTRDSQRSHV
GLLQTFWRGLGAKESTSGFESQHRLKGIRCSGSVTYKKAKETVHSTSDAASNGESSLTKR
PNNCQPSVSIQLQSNMEEKTSKFVLKDERNNSSTEVENIPCNMVPSITRGSSIESPQRPA
PSSLPLKNFLNVTSWGCSGNSTMVPSHILANEQIHDKSSSLREPLTEPGEYENLPFHGLQ
TAPNKFSTTPTNFNNNTNAVRVAQRPKELIGNINQPSVGLYQDCQATHDPLLYHQKYFCD
QDALNDQRSQYTTMHRPPNNVQYNQSLFKPDSNLQDQHNLSNCISKSYTEYYQQHQRSEK
LQMIFPQGASKELNSNSLCNTDHTPHSALVNINLRKYDRTEEELLGNMPRARHRKGTLNV
ENKFYSLKHLGGIEVRNQDLDKDYPIGGTTSSTPSATDDSSLSKCKIHNSLGCNRLCNVG
TNVQPMRVYDPPGYQNMVLERADDQITLSKKDECNLATVQTHTHPGKDKIKNHHHWIHQH
REKKDEGLGSDFHQLEPERISIYRSDSGISNSSYESQFSKPKMATLNSSSGPLVRKYAHR
NIKVHNNVFNTSNVTESEAQLDDSSTLHQSCTVQSFAPSHCNRPQPRNRYSEETTKNECE
QHQLGHQSLRPASTPSECISLDTSSRSEYIMSTVPAQSDSVETPNEKIQMLAINPLLVKN
WNNESYTGNKINKKQRRQTINNPYEHIQSHPYARPGDVCEVSRKAQSNSSEAFKTYNYGS
KSNSSAPQTAAPEHSKVKNATKICKKNGIGANREHYEGMLASKHIQGSRLGSLADIDDFP
SQGPLNALVGNPADCLVARRPIRLPLRKHHTFHFQSTQTANGKLQQLRERLQLQLHESRK
VDQEKFPLVFDALELSEKHAFKPISPIPSLNNSAVQSTGEQKQVDFPKHGSVRHLKGAED
DEDLGYSFCEEECVVENDINPTSDNLKTAPTNSSCSSTAVESANPINAQIFDDEFIYADL
ESQHYGPINYKAASLYSQVKKNKESGALDDLK
Download sequence
Identical sequences M9NE05
FBpp0293373 FBpp0293376 NP_001246890.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]