SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293459 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293459
Domain Number 1 Region: 79-205
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-27
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 2 Region: 352-480
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.89e-24
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 3 Region: 1474-1656
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.11e-22
Family NAD kinase-like 0.073
Further Details:      
 
Domain Number 4 Region: 1870-1933
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-18
Family SAM (sterile alpha motif) domain 0.0071
Further Details:      
 
Domain Number 5 Region: 251-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.03e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000608
Further Details:      
 
Domain Number 6 Region: 185-248
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000703
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293459   Gene: FBgn0085413   Transcript: FBtr0304920
Sequence length 1936
Comment pep:known chromosome:BDGP5:3R:3640083:3679622:1 gene:FBgn0085413 transcript:FBtr0304920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLKLDTLHVQRSPRGSRRSSPSSGRSSACSSGSISPVPIIPIISISHDGDESESESEI
ETEPARLFQRRMSTKCTNNLAAIIKEGFLLKHTWSFQRWRRRYFRLKRNMLFYAKDEKCD
VFDDIDLSDLCYFECGIKNVNHSFQIITPTRSLVLCAESRREMEDWLGSLKTATAPQRPR
GDSFLIEQHDILSNHHHWYATSHARPTYCNVCRDALSGVTSHGLSCEVCKCKVHKRCAAK
SIANCKWTTLASVGKDIIEQADGIIMPHQWMEGNLPVSSMCAVCKKTCGSVLRLQDWRCL
WCRATVHVACRPQMAVACPIGPAKLSVVPPTSVHSISTDDAWDVASPKGNFSPLLVFVNS
KSGDNQGVKFLRRFKQLLNPAQVFDLISTGPSLGLRLFRHFEMFRILVCSGDGSVGWVLS
EIDRFNMHKQCQVAVMPLGTGNDLARVLGWGSSCDDDTHLPQILERYESASTKMLDRWSI
MVFEKAIPVPKTPKMSISTEQEAMLTGMVTSANHHLRFIVETNDTQTLIRSTRNLCDTVD
DLVCRISEHHKDDEQLAVKCDILRQKLNMLLDALQEEEIGAHSGDDLIATIRSLIARSIP
VTPGSNAYLLNPNISIEKTEKDQINTKERRNSRSLRSSEKEALQCRANSVKRAIYNVVEH
SEPGRPKRYQRKLSITPFEALKLPTASGESTPCTSPLPIIPPINIISPTMETSRLTCISP
LPDTRRDSVDENFFNSINLPAPRQFADSRRSSGVEVIQEIEEGANGETVYRKSRMSLTGG
ANIDDAGNRLSPCSDAGENTPTERKVDFLRVPIHTGEPIVDPLCDYRPHEVFERTYYMTR
EMDKGKEKDKEKDKPVEIDKEKDTCVEKEGSMPAEKLVHTCNLQVPGVVVTPNPQNVYSS
ASITIIDTDAQTTTEQSSSDDLGGEASDVLSAISNEECSVASEIFDKQDAGQTVGDIIQN
MDASNFTHIDSPETSDETEAMPGESIMDDISSVLGHDITYALQDNTLTDDTTTLCSEHAG
PPKPPRKKSLSALSRTQAHPRRRNSSPPRMARLARMDSDDNPQQFGFENIVFEIDNRCDD
QKMREPPRYCSLAQFVEGNDIARQSFKQLMLEQHRGGDNDSDYPEHEQTPTNKGANLLAT
TSEDELSTQTAIKIEIQDIDATVRNLNSSMKPNTILTTSTSPTKKSGHGQDVKRITFDES
CKKESFDDVNPNYPQISVVVRPPTPLRGDCIKPTVSLLPVSSGGAMTVSMTCSGMLGVRA
MNASEIRRHSSHAPGLAVREFDKDKDRRHSGFNPNQLTLDPEHARFLSSSPAASRRISCG
SLFKKKNKKIGTKRSYGLFSVRFFVVAEPDFRLATLALIRPLIPLPNEALPNLQTLKGSK
SSLFMGSTLFGFDHLASAEKDKEEKSGKDKEKTPTDETNRKLPIINPLVRLPNWPNLANG
GGFISKCLLANADTLCAAVSPLMDPDETLLAGYHEKCVMNNYFGIGIDAKISLDFHNKRE
EHPEKCRSRARNYMWYGVLGSKQLLQKTCKNLEQRVQLECDGQRIPLPELQGIVILNIPS
FMGGTNFWGSSKKDDIFLPPSFDDRVLEVVAVFGSVQMAASRLINLQHHRIAQCQSVQIN
ILGDEEIPIQVDGEAWLQPPGMIRILHKNRVQMLCRNRSLELSLKSWQEKQRQHSISIQR
DASSTASEHANSTDEVISERECYVLLNFIEAVSSLVKWVKFLIISHPALQHDLYEVACRA
SEALESIHPQGKLLEGPSLRTKLVEVIDSSRQLYDDACTLLRDRGHSLILREDLETKLSA
ALANMEMELKKCSVQKCIDGKLRAYFNVLAPNEESDGRRKSRPFWVRLRSGSTAGQQAFK
PPLTNTREAANNWSVNEVVTWLETMQLSEYVDSFLKNDIRGKELLTLGRRDLKDLGVVKV
GHVKRILQAIKDLSEN
Download sequence
Identical sequences A0A0B4K6B6
NP_001246971.1.81976 FBpp0293459 FBpp0293457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]