SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293518 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293518
Domain Number 1 Region: 99-198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 259-334
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00022
Further Details:      
 
Domain Number 3 Region: 18-94
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293518   Gene: FBgn0262737   Transcript: FBtr0304981
Sequence length 359
Comment pep:known chromosome:BDGP5:3L:21837888:21919799:1 gene:FBgn0262737 transcript:FBtr0304981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDNNTSSSAGGASIKHEDPSVTLTIRLIMQGKEVGSIIGKKGEIVNRFREESGAKINIS
DGSCPERIVTVSGTTNAIFSAFTLITKKFEEFNDVGKVGKTQIPIRLIVPASQCGSLIGK
SGSKIKEIRQTTGCSIQVASEMLPNSTERAVTLSGSAEQITQCIYQICLVMLESPPRGAT
IPYRPKPQVTGPVILANGQAFTIQGNYAVPTQEVAKNPLASLAALGLAGMNPASTGGINH
TALAALAGSQLRTANPANRAQQQQHEMTVSNDLIGCIIGKGGTKIAEIRQISGAMIRISN
CEEREGGNTDRTITISGNPDSVALAQYLINMRISMETAGLPIPGYHYIAPSAIVKTPIH
Download sequence
Identical sequences A0A0J9S140 A0A0Q5UHQ7 A0A0R1DZI6 A4V2A4
NP_001262197.1.81976 NP_730700.2.81976 XP_015014164.1.56816 XP_015051025.1.41174 XP_016032914.1.80810 XP_017013499.1.47939 XP_017022983.1.37106 XP_017072326.1.81094 XP_017122983.1.32376 FBpp0293518 FBpp0305424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]