SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293519 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293519
Domain Number 1 Region: 103-202
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 334-408
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.87e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00022
Further Details:      
 
Domain Number 3 Region: 18-99
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.18e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293519   Gene: FBgn0262737   Transcript: FBtr0304982
Sequence length 433
Comment pep:known chromosome:BDGP5:3L:21837888:21919799:1 gene:FBgn0262737 transcript:FBtr0304982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDNNTSSSAGGASIKHEDPSVTLTIRLIMQGKEVGSIIGKKGEIVNRFREESGAKINIS
DGSCPERIVTVSGTTNAIFSAFTLITKKFEEWCSQFNDVGKVGKTQIPIRLIVPASQCGS
LIGKSGSKIKEIRQTTGCSIQVASEMLPNSTERAVTLSGSAEQITQCIYQICLVMLESPP
RGATIPYRPKPQVTGPVILANGQAFTIQGNYAVPTQETCPVFPLALATGGLHAGISGLAD
PLLKGAHLQGAIPAHHHHLQQMPDVAKNPLASLAALGLAGMNPASTGGINHTGELSASAA
RCQTDFQSNLGSAPAALAALAGSQLRTANPANRAQQQQHEMTVSNDLIGCIIGKGGTKIA
EIRQISGAMIRISNCEEREGGNTDRTITISGNPDSVALAQYLINMRISMETAGLPIPGYH
YIAPSAIVKTPIH
Download sequence
Identical sequences A0A0J9URB5 A0A0Q5UKZ0 A0A0R1DZH8 M9NGB9
FBpp0293519 NP_001246876.1.81976 XP_015014163.1.56816 XP_015051031.1.41174 XP_016032920.1.80810 XP_017013454.1.47939 XP_017072320.1.81094 XP_017122977.1.32376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]