SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293529 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293529
Domain Number 1 Region: 802-999
Classification Level Classification E-value
Superfamily PUA domain-like 4.97e-36
Family LON domain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 679-732
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000186
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 354-451
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000121
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Domain Number 4 Region: 177-228
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000114
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293529   Gene: FBgn0052369   Transcript: FBtr0304992
Sequence length 1066
Comment pep:known chromosome:BDGP5:3L:7770318:7802925:-1 gene:FBgn0052369 transcript:FBtr0304992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSQGYCQQEQQDQGHHMPPSSPIQCYLPHNDSQNSLHYLLAESFAKVGSLPEAFDVYE
LIASRQFDGHVPLDKLNTLASALTTHIRQMGGIATPTPTPTPTPMSAVHVKSPRISERLD
MMPWSRYHHQGKQNQAEQGEFLRGVGESMDEAGDSPLDMHSPTRELRVPSPLQDLEDFDP
LMCPLCSDILRCPVTTNCGHTFCRQCCETITQCNICQVRFPRIQASSPGPPVCALTTTTA
SGAGSSLFTAPSNHNANLSLISFPVGYGVQLSSSVQRLAAPPMTVTTTTVASTTATATTT
MASTSAAAALGLSAYPSAHGGGIGSTAMKFMPDVLVRRLVEKWWGPDLQAKKISEKASSC
MHLNLLDDALKFCNASLEKSPANFKSLCLRAEVLLKLSHYQSSLADIENALRTRCTSPKA
HYLRALALSGLGRLEEALYNGFLAICLDKKTNLSNSEIFQHDLAKILQRLLAHMPKNRTS
LSSATVPVFQQQHRNFATSRAPYPLLWEQVRRRRKQQHHHHHHHHHHHVHLDDVEDEFGH
YNNYIMAGDDMEEEVEVEVEGGEPGSLHLDGDFLFPSALDFMDHHRHQRHVFEQKQFDLQ
PRRHANRKHCKRKWSVAMESMGGKDLEEEDVDRAHAAGESQRCSRLFAGVLDRTQQELQR
LKKLDKSAPSLAVSSVAGQLIDASDFDCVVCSRTLWKPVVTPCGHTYCLVCLDRCMDYNS
PCPLCMSPLVEFNVNASASTSASQHPNPNQNQIHLHPGSSSPVPFALAKRPVTKFLEAAM
KRFIPDHYEARFRQEIDQEPSVPVFICTAAFPAVPCPLFVCEPRYRLMVRRAVESGDKTF
GIVQPNGGKSRYYDVGTILDIRDCVQLGDGCSILSTIGCKRFKILARNEKDGYETAKVEY
ICDEPIADEQVKILAGMQGVVLAKASEWFESLSTEQKHEILQSFGQMPPLEPNWELISDG
PAWAWWIIALLPLSQQLKVDILATTSLEKRLRAIDKTLDWLHDLSHPQQPAHHPMNHHQQ
APQSPQQAHHLDLDCEEQEGASSGSDECCLFAETGNEPHTDEELLL
Download sequence
Identical sequences Q9VSB2
FBpp0076499 FBpp0076498 FBpp0293529 NP_001246660.1.81976 NP_729296.1.81976 7227.FBpp0076498 FBpp0076498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]