SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293530 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293530
Domain Number 1 Region: 652-936
Classification Level Classification E-value
Superfamily ARM repeat 1.39e-23
Family Armadillo repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 931-1008
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.72e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 1080-1223
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000000000068
Family Toll/Interleukin receptor TIR domain 0.007
Further Details:      
 
Domain Number 4 Region: 1012-1074
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000024
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293530   Gene: FBgn0262579   Transcript: FBtr0304993
Sequence length 1637
Comment pep:known chromosome:BDGP5:3L:8067406:8101936:1 gene:FBgn0262579 transcript:FBtr0304993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRLSGLWCKKTTLSITQQEEQQYNREIRNEKSPPRSGRKSNRIRTKSSGSGDGRGTFR
LASIRRLSLRDNPKKTIKTPLDNPSIATVEQTFRELTKRADLDSSMKVNAQLMPTVKMTD
FSDSSPSGVLSPPTSLIENFHKKNSSPQPLGSSSAISTLTPTTLNGSVVGGGVGGAGHHS
IENGRQINTSSSSCSSLKETSHQSTSTSQQVVNSSSSTTTRVEKKSQRLHHHITSSSSSS
STTQALSTSSEMKAAEIKRDLTNIQKSMSEINDLAKERITGGPGSISTTSASAITAPSTM
SQTTTSRLAPKLTSAHPSIDDLRGLSRQDKITQLQKKIRASFENLVDHDDSNVIVTLPDD
DDCPHNHFGSGLNLTHPTAAQLSASGLSGSSKTIDTIKFQEKSMKTESKTKVVTDGFSSE
QATSNSAEMKRLQAGDIDYQESKGASAMRNRLEVDGVKTEENAAVIKEALSLRTGDITQQ
ASNNVAASSITVQSENFSADKKAISQSQQSQTMTSNGIISQEKHVSSASQANYSMSHKGV
SSTGSSMITSSSQMSAMNGQMLKLADLKLDDLKSLTAGSGQQEIEQTINKYSNMLTSIVS
SLQEDERGGSAITVHDVGGKKSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLD
LLMKNCVKPDLQFSSAQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTG
ILEHLFKHSEGTCSDVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMI
LRKVPMWLFPLAFHNDDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSA
FARSNLAHAHGQSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINA
IEALKNVASCPNAIASKFAAQALRLIGETVPHKLSQQVPLWSVEDVQEWVKQIGFNDYID
KFNESQVDGDLLLKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAKMHQFL
SEIGTDYCTYTYAMLNAGIDKCALPHVNEDMLMTECGIHNSIHRLRILNAVKNLENSLPS
SSEENMAKTLDVFVSYRRSNGSQLASLLKVHLQLRGFSVFIDVERLEAGKFDNGLLNSIR
QAKNFVLVLTPDALHRCINDEDCKDWVHREIVAALNSNCNIIPIIDQQFDWPEVERLPED
MRSVAHFNGVNWIHDYQDACIDKLERFLRGEKNIDRIAAMVPGTPGSVSYQRMHSNDSDY
QSGGAGAGSGAGTGGGGGGGVTGSVVDGLMVAANGSGQANHQANRYRQSPSPARQRGSTS
QLSGYSRAPSKRSQILTPYRTQQAALLHKTGAGSASMQNMMPLAYLPPRRSSAAGLGHGS
GSGMGSGYRSHSVDGLLDQAGSTPEQRIAAAAAKVTAGSTALTNASSTSTLQPEEEVTDA
ALNDSVTRRDKHTLSPPGNVQQHRKSRSLDHILSKQTLAELLPPSSELADGTQSMQNLAI
PMTPQPQRRDTSSSSKSPTPERPPQPAMERVRERQSPEGVSATESEREDQPEECLRHGNQ
QRASASVHRGASLTSNKTSNSSLGSNFSAGGNNKTIFNRTMKKVRSLIKNNEMEDEELSG
IILSKATSPNAGRMIFW
Download sequence
Identical sequences A8JNN1
FBpp0293530 FBpp0111510 NP_001097541.1.81976 7227.FBpp0111510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]