SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293531 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293531
Domain Number 1 Region: 375-661
Classification Level Classification E-value
Superfamily ARM repeat 5.04e-24
Family Armadillo repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 654-731
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 803-946
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000366
Family Toll/Interleukin receptor TIR domain 0.007
Further Details:      
 
Domain Number 4 Region: 735-797
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000121
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293531   Gene: FBgn0262579   Transcript: FBtr0304994
Sequence length 1052
Comment pep:known chromosome:BDGP5:3L:8094119:8101936:1 gene:FBgn0262579 transcript:FBtr0304994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNQAPWPVRKGIFRSSGQSDFTPTRSPSPIVEMPLSPPPVATPSNRFGINSPLSPPPQP
IQVVAGSTTATTMSTASAARVSGAAASTSSSSSSSSSSQCSSQTSSSSSSHTRVRKSSNP
PPQPITSCPLSPPPPPPPQQQQQLPQQLPPPTPINNTNHSAITTPNHNNNHNCNQMRNVR
EIPIEVEQSKEALSLRTGDITQQASNNVAASSITVQSENFSADKKAISQSQQSQTMTSNG
IISQEKHVSSASQANYSMSHKGVSSTGSSMITSSSQMSAMNGQMLKLADLKLDDLKSLTA
GSGQQEIEQTINKYSNMLTSIVSSLQEDERGGSAITVHDVGGKKSQYLEKINEVIRRAWA
VPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSSAQLLEQCLTTENRKHVVDNGLD
KVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSDVIRLGGLDAVLFECRTSDLETL
RHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHNDDNIKYYACLAIAVLVANKEIE
AEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKHWLKRLVPVLSSNREEARNLAAF
HFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIASKFAAQALRLIGETVPHKLSQQ
VPLWSVEDVQEWVKQIGFNDYIDKFNESQVDGDLLLKLNQDNLRADIGIGNGILLKRFER
ELQNLKRMADYSSKDTAKMHQFLSEIGTDYCTYTYAMLNAGIDKCALPHVNEDMLMTECG
IHNSIHRLRILNAVKNLENSLPSSSEENMAKTLDVFVSYRRSNGSQLASLLKVHLQLRGF
SVFIDVERLEAGKFDNGLLNSIRQAKNFVLVLTPDALHRCINDEDCKDWVHREIVAALNS
NCNIIPIIDQQFDWPEVERLPEDMRSVAHFNGVNWIHDYQDACIDKLERFLRGEKNIDRI
AAMVPGTPGSVSYQRMHSNDSDYQSGGAGAGSGAGTGGGGGGGVTGSVVDGLMVAANGSG
QGGPTSTTSTTSSTPNSNSSSSSNQSPPAAPA
Download sequence
Identical sequences NP_729327.1.81976 FBpp0111511 FBpp0293531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]