SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293534 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293534
Domain Number 1 Region: 401-685
Classification Level Classification E-value
Superfamily ARM repeat 8.19e-24
Family Armadillo repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 680-757
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.96e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 829-972
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000549
Family Toll/Interleukin receptor TIR domain 0.007
Further Details:      
 
Domain Number 4 Region: 761-823
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000165
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293534   Gene: FBgn0262579   Transcript: FBtr0304997
Sequence length 1386
Comment pep:known chromosome:BDGP5:3L:8089622:8101936:1 gene:FBgn0262579 transcript:FBtr0304997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAEIKRDLTNIQKSMSEINDLAKERITGGPGSISTTSASAITAPSTMSQTTTSRLAPK
LTSAHPSIDDLRGLSRQDKITQLQKKIRASFENLVDHDDSNVIVTLPDDDDCPHNHFGSG
LNLTHPTAAQLSASGLSGSSKTIDTIKFQEKSMKTESKTKVVTDGFSSEQATSNSAEMKR
LQAGDIDYQESKGASAMRNRLEVDGVKTEENAAVIKEALSLRTGDITQQASNNVAASSIT
VQSENFSADKKAISQSQQSQTMTSNGIISQEKHVSSASQANYSMSHKGVSSTGSSMITSS
SQMSAMNGQMLKLADLKLDDLKSLTAGSGQQEIEQTINKYSNMLTSIVSSLQEDERGGSA
ITVHDVGGKKSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDL
QFSSAQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEG
TCSDVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPL
AFHNDDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHG
QSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCP
NAIASKFAAQALRLIGETVPHKLSQQVPLWSVEDVQEWVKQIGFNDYIDKFNESQVDGDL
LLKLNQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAKMHQFLSEIGTDYCTYT
YAMLNAGIDKCALPHVNEDMLMTECGIHNSIHRLRILNAVKNLENSLPSSSEENMAKTLD
VFVSYRRSNGSQLASLLKVHLQLRGFSVFIDVERLEAGKFDNGLLNSIRQAKNFVLVLTP
DALHRCINDEDCKDWVHREIVAALNSNCNIIPIIDQQFDWPEVERLPEDMRSVAHFNGVN
WIHDYQDACIDKLERFLRGEKNIDRIAAMVPGTPGSVSYQRMHSNDSDYQSGGAGAGSGA
GTGGGGGGGVTGSVVDGLMVAANGSGQANHQANRYRQSPSPARQRGSTSQLSGYSRAPSK
RSQILTPYRTQQAALLHKTGAGSASMQNMMPLAYLPPRRSSAAGLGHGSGSGMGSGYRSH
SVDGLLDQAGSTPEQRIAAAAAKVTAGSTALTNASSTSTLQPEEEVTDAALNDSVTRRDK
HTLSPPGNVQQHRKSRSLDHILSKQTLAELLPPSSELADGTQSMQNLAIPMTPQPQRRDT
SSSSKSPTPERPPQPAMERVRERQSPEGVSATESEREDQPEECLRHGNQQRASASVHRGA
SLTSNKTSNSSLGSNFSAGGNNKTIFNRTMKKVRSLIKNNEMEDEELSGIILSKATSPNA
GRMIFW
Download sequence
Identical sequences A8JNN3
FBpp0293534 FBpp0111514 NP_001097545.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]