SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293549 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293549
Domain Number 1 Region: 590-806
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-48
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 1221-1465
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000541
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 
Domain Number 3 Region: 796-900
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000689
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0293549
Domain Number - Region: 1024-1112,1208-1280
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0018
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293549   Gene: FBgn0262562   Transcript: FBtr0305012
Sequence length 1542
Comment pep:known chromosome:BDGP5:3R:13594157:13605906:-1 gene:FBgn0262562 transcript:FBtr0305012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLTDTIQSETDCLIKEDVPPPVQPVVEITPPASSVSGSAPNLATLMEEQLPLEAPPDN
FLQTATTCEIPVPVYECAAQEWLETPAQEWVEVAPEEFGIVPETIQPPIPHAACKISQTP
STLTTAVRSDLVPTISVSRSSEEGDELAKIEDEPQVEVATTARNTSMDRHIREYSQDDLD
LANVDLRSSLEAIATPRHSTDERQRRHLDKSTKRKGMYIDNADWQAPTEAPQRGLALDIS
VANLNAIKPESPEANTPGASQMYISSPQSSYSFELNTPELEKGSPSWGSGGLVRDKAQLL
SNFSCHSSEEKDDASCRSLSYLRTDSTSDNECDRAIRERERERITSSPTPSSGDYDYKRF
SKRPLRGPYGQMLEAEMKKPNRMHFEEILEELRETDSLHLRGSAPGVAAGGTVGPSRNLP
QYSNSMRVRKTSTFLPVPSHARAASTPSQLEHASKGISAATAQISVSAKNLSQAELDDQV
HHMKRAASEAPAPKSNHSKRSQSMSTERPSQHHHHHGHGHGHSHGHHHAGKRSLDAGSGD
KAAKNAPLAGGTSGSGSGGGGKAGLKPTPALLAELLKGSSENMISEQRKKTIADTRTYVV
QEIYRNEQSYVESLQTVVVKYLKVLKAPEHAGMIDTRTVDEIFFMVPDILEIHEKFLSDL
KSRLDDWDVQQKVGDAFMDTFSKLEVLEVYTSFVNNCNRAKNAIRSMKHQRPSFSKFLET
TAREHKGKLTLDNLLIKPVQKFPNYELLFQRLIKHTDHDHPDTKHLQDVLKLVHDILVHI
NCKEREIMENGQREATLRELEGVIEGITDLIAPERQFLLFDLVSMPSGQGARKDRGFFLF
NDLLVLTSIKKRSGTIRKPNSSICPGTVATTLDTNKYKFLTKISLDCLEIVKSKDENIKR
IVSEIETLAEDCNKLQQITDITVTIKYPHQYLEDVIRELHREVQRQLSERQTNDTQLNML
ELTVSSPNGNQKLAVVFSKTEKRTQWEESFNEAKQKLAATLERHPIPEFLTSIPIRKTRA
GLQFTCAAATLSDNRDVWVCNSDGYVGQVCIMSLHPEPNVTSCNGVCNARILCVASVPAY
SSAASSRNSSSEQPAGSGGQEEKDKRHTPQSYTQQLRDYRKSISPSFQSASASATATPEK
KKLTPTPTPVAGGEPADAATTGGSDTQLELNLSSSDDETEAAAASLNVAGSTGSTLVERV
PSPAPSYHGHQDSNPEEGESNQSTMWIGTEDGCIHVYNSTDNIRIKKNRIKIEHHSAVYS
ILYLDNRVFVSLANGDICVYLRDGATSWNTCSSHCLSIGTVTSPVNKLLNVNGRLWCSIQ
GIIKVLDVETLTVVNQIQISSDSKPITNMTVSNNHVWISIQNSAHIKCFHSNTHQLVTEV
NLAPAVNKMLSNCDEIIRQHKAACLRVTSLLCCKDLIWIGTSAGVLLTIPAQGYEKGAIN
IVPTGIPHGHTGHVRFLTFVETTGLEGAASGAGGGRDAGSSNSDEYTKQGSIKHSKSKSE
TNNTLIISGGDGYEDFRNSGANSLSEIAGREDSTNHLLIWQI
Download sequence
Identical sequences A0A0B4K728
NP_001247157.1.81976 FBpp0293549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]