SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293573 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293573
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.62e-18
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Domain Number 2 Region: 848-915
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.55e-16
Family SAM (sterile alpha motif) domain 0.0025
Further Details:      
 
Domain Number 3 Region: 741-826
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000394
Family SH3-domain 0.0025
Further Details:      
 
Weak hits

Sequence:  FBpp0293573
Domain Number - Region: 264-323
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00706
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293573   Gene: FBgn0051163   Transcript: FBtr0305036
Sequence length 1064
Comment pep:known chromosome:BDGP5:3R:17959557:18121848:1 gene:FBgn0051163 transcript:FBtr0305036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSI
RSLREKGAASVYFMLNDPNSLSGSMEILCETPPNNELELVLREQLETDGVRLTAHPYSTP
DGQRGHLEGLASVYCELLMAPFGDILATIERARQAAWAERSPLHSAAQVVGGSGGAGGST
GSGSGGAASGGSGGSSGVLHHRQQHGHRGHSMHGAGLPNSHSQPIYVPGKYSPSSCLSDK
EEDEIYGFGYGVFAPRVARGGLTQQQQLLQQQTLQTQQSIQQQQQQMQQQQQQLPIVPGQ
QQQGPHQHQTLPPNVAHLNFVQQNCLSPRSAYFYEFPPTAEGRETKKRTTLARLLKGLKT
VNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSFEETIHRLKVQEAMRKKEKFQR
EHEEILRDIRQGLLQMSRGEGRMDDTYMYDEALRTGGGMGIAGLGMPLGVGGNGGGGGAA
HYAVSALHHQGHWYDEPPYESDPDDFLMAGLNCGPAATIQGGRVRFSNNRESTGVISLRS
AGDISLPQRGPPRRGLIVPQQPPNPPTIIPLTHARSHDRESGDYAGSISDLQSVTSRFST
VSIGTNNCTARYRTLSGGIGESPSLSPSPSSDYEDIGVTRGHGCLPPSLLAAKAKKNGLP
HGKANTICQKATVHHSGEMRSSAKEIGAFNENGRNFVATKDTSRDFSNSQDNTDRGSMSD
QAFACSASSVESLPSASGSSTQALVRPGSPHSSISAEDRTSMASCICKAKALVDSLPNPY
DKEALKFKKGDLIDVLSMNASGIWKGRCHGRVGHFKFINVEVLPEQRMKNSSSKTLAAGS
RLANSGNGSHNGGPCSVEDLLIRIGLKEYTSVFVLNGYEDLELFKELEPADLDYLGILNQ
EHRAKLLTAVQLLHDIECSDVDIPGSSSENDEARLNNINMKHGASPFGRRHFPRDSGCYE
GSPLPSSQTPTQAVNSTDESNSLDDVVTKCSSEIMKRVESARRCKDNPFKTTLPGGGRLG
KKSFLGGNGLMADDTLTRGGLSEKSSDSGVSSSSLSSGPLKSST
Download sequence
Identical sequences Q0KI30
FBpp0290250 FBpp0290250 NP_001036742.2.81976 NP_001247233.1.81976 FBpp0290250 FBpp0293573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]