SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293574 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293574
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.62e-18
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Domain Number 2 Region: 811-881
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.2e-16
Family SAM (sterile alpha motif) domain 0.0025
Further Details:      
 
Domain Number 3 Region: 704-789
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000381
Family SH3-domain 0.0025
Further Details:      
 
Weak hits

Sequence:  FBpp0293574
Domain Number - Region: 264-323
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00162
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293574   Gene: FBgn0051163   Transcript: FBtr0305037
Sequence length 1034
Comment pep:known chromosome:BDGP5:3R:17959557:18121848:1 gene:FBgn0051163 transcript:FBtr0305037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSI
RSLREKGAASVYFMLNDPNSLSGSMEILCETPPNNELELVLREQLETDGVRLTAHPYSTP
DGQRGHLEGLASVYCELLMAPFGDILATIERARQAAWAERSPLHSAAQVVGGSGGAGGST
GSGSGGAASGGSGGSSGVLHHRQQHGHRGHSMHGAGLPNSHSQPIYVPGKYSPSSCLSDK
EEDEIYGFGYGVFAPRVARGGLTQQQQLLQQQTLQTQQSIQQQQQQMQQQQQQLPIVPGQ
QQQGPHQHQTLPPNVAHLNFVQQNCLSPRSAYFYEFPPTAEGRETKKRTTLARLLKGLKT
VNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSFEETIHRLKVQEAMRKKEKFQR
EHEEILRDIRQGLLQMSRGEGRMDDTYMYDEALRTGGGMGIAGLGMPLGVGGNGGGGGAA
HYAGGRVRFSNNRESTGVISLRSAGDISLPQRGPPRRGLIVPQQPPNPPTIIPLTHARSH
DRESGDYAGSISDLQSVTSRFSTVSIGTNNCTARYRTLSGGIGESPSLSPSPSSDYEDIG
VTRGHGCLPPSLLAAKAKKNGLPHGKANTICQKATVHHSGEMRSSAKEIGAFNENGRNFV
ATKDTSRDFSNSQDNTDRGSMSDQAFACSASSVESLPSASGSSTQALVRPGSPHSSISAE
DRTSMASCICKAKALVDSLPNPYDKEALKFKKGDLIDVLSMNASGIWKGRCHGRVGHFKF
INVEVLPEQRMKNSSSKTLAAGSRLANSGNGSHNGGPCSVEDLLIRIGLKEYTSVFVLNG
YEDLELFKELEPADLDYLGILNQEHRAKLLTAVQLLHDIESTNFARTGSDVDIPGSSSEN
DEARLNNINMKHGASPFGRRHFPRDSGCYEGSPLPSSQTPTQAVNSTDESNSLDDVVTKC
SSEIMKRVESARRCKDNPFKTTLPGGGRLGKKSFLGGNGLMADDTLTRGGLSEKSSDSGV
SSSSLSSGPLKSST
Download sequence
Identical sequences A0A0B4K6C1
NP_001247234.1.81976 FBpp0293574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]