SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293578 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293578
Domain Number 1 Region: 1052-1203,1261-1441
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.72e-52
Family Diacylglycerol kinase-like 0.017
Further Details:      
 
Domain Number 2 Region: 857-958
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.76e-18
Family Ras-binding domain, RBD 0.0073
Further Details:      
 
Domain Number 3 Region: 4-56
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.42e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 4 Region: 116-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000108
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 5 Region: 66-119
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000401
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.043
Further Details:      
 
Domain Number 6 Region: 766-826
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000165
Family Ras-binding domain, RBD 0.043
Further Details:      
 
Domain Number 7 Region: 960-1038
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000168
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293578   Gene: FBgn0051140   Transcript: FBtr0305041
Sequence length 1498
Comment pep:known chromosome:BDGP5:3R:19788902:19808954:1 gene:FBgn0051140 transcript:FBtr0305041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGGHSFVKKTFHKPTYCHHCSDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAP
CIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENA
TYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMY
LPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSKTSLVRDYSCLGETSNEAEQD
RERDQDQPEEEPEEENTEQDSALQLTTSTSNVIGNLQKWPSANSSLHLLYTNLFRKLGQG
KRRRKRGISSGGLSPSEDEDDVDGGVCDISGGDLSDDYDHCDVALRRRSLRSRQPRDVSE
TDYHGDAEAEAEGETVPRESCYETSDTGGELTNTDDLDSSLNLISNLSYNSSNNSNACNV
PGGATAPDARNTATTSTTAPGKSGHALSVQGGRQQPKTGALAQIKPKPKPILMPKHKAQG
KGGSLSSPLSNSNSSDCSSASPSAPATLLQLSPVGRSKSFQESAAITAVSRYKKYGRGLF
QRRRSKRSPKNAVGVGGKSNYSLDRLSQNIEITIQDEDGNFHPYDDNYHMLAGRLDATDV
DDDVGFDDLYLDDRPSGASDDVAFAGDISDGGASSRSRASDASDGHVLGRLLRQVRQGLS
VGWRKPRYQKRRARSISEEFSSGDTPRFKDEESASKAESGHGPSSGGAGGGGGSGGAGGS
SAAGASASAAGGSSGHYRPDSGSGHKSDKSEKDREKKEKEREEKDIEMIKVFDGNNSFRR
QQYRVIIVQRTYTLEQLLTTALRAFHITRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLV
HLEGKRPAIYLRFHDRDRGHVRVYPGKLQCSMLEDPYVSVPVDNSTVIKDLIRDALDKFG
LQDNQIQDYRCSEVLLDRGVTERILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPH
GPNIALFVGNLPTGLSQRNYEQILNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRA
FYNLRETIIEDKKLLVLLLPNIEPSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNP
YQVFDLDNGGPLPGYVQPITVFVIRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQ
CLDNVGQDSECSSPPCAIVPLGTGNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDR
WTVVFHPEDKPEEPAMKAPSQTTGKKKKAHQAHLSQSQQTNQHHQLPALTSSDISGGAQN
EDNSQIFVMNNYFGIGIDADLCLDFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAV
KDLQKELRLEVDGKIVELPPVDGIIILNILSWGSGANPWGPDKDDQFSTPNHYDGMLEVV
GVTGVVHLGQIQSGIRTAMRIAQGGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKA
TMLKKNKLKMKRRNTEPTMMVAGSAAPPLSLALPPSVGEVGVAGEGAEGDGGTNNTDF
Download sequence
Identical sequences A0A0B4K716
FBpp0293578 NP_001247275.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]