SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293599 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0293599
Domain Number - Region: 446-732
Classification Level Classification E-value
Superfamily Tropomyosin 0.000108
Family Tropomyosin 0.00087
Further Details:      
 
Domain Number - Region: 1324-1445
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00282
Family FCH domain 0.083
Further Details:      
 
Domain Number - Region: 315-495
Classification Level Classification E-value
Superfamily Tropomyosin 0.0575
Family Tropomyosin 0.0063
Further Details:      
 
Domain Number - Region: 880-1079
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293599   Gene: FBgn0259246   Transcript: FBtr0305062
Sequence length 1781
Comment pep:known chromosome:BDGP5:2R:5391293:5424980:1 gene:FBgn0259246 transcript:FBtr0305062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRDDYNPVTSSGVRSPGRVRRLQELPTVDRSPSRDYGAPRGSPLAMGSPYYRDMDEPTS
PAGAGHHRSRSASRPPMAHAMDYPRTRYQSLDRGGLVDPHDREFIPIREPRDRSRDRSLE
RGLYLEDELYGRSARQSPSAMGGYNTGMGPTSDRAYLGDLQHQNTDLQRELGNLKRELEL
TNQKLGSSMHSIKTFWSPELKKERALRKEESAKYSLINDQLKLLSTENQKQAMLVRQLEE
ELRLRMRQPNLEMQQQMEAIYAENDHLQREISILRETIKDLECRVETQKQTLIARDESIK
KLLEMLQAKGMGKEEERQMFQQMQAMAQKQLDEFRLEIQRRDQEILAMAAKMKTLEEQHQ
RHIAVLKESLCAKEEHYNMLQTDVEEMRARLEEKNRLIEKKTQGTLQTVQERNRLTSELT
ELKDHMDIKDRKISVLQRKIENLEDLLKEKDNQVDMARARLSAMQAHHSSSEGALTSLEE
AIGDKEKQMAQLRDQRDRAEHEKQEERDLHEREVADYKIKLRAAESEVEKLQTRLERAVT
ERERLEIKLEASQSELGKSKAELEKATCEMGRSSADWESTKQRIARLELENERLKHDLER
SQMQLEEQTTLHKTTFGRTTMTTSQELDRAQERADKASAELRRTQAELRVTQSDAERARE
EAAALQEKLEKSQGEVYRLKAKLENAQGEQESLRQELEKAQSGVSRIHADRDRAFSEVEK
IKEEMERTQATLGKSQLQHEKLQNSLDKAQNEVDHLQDKLDKACTENRRLVLEKEKLTYD
YDNLQSQLDKALGQAARMQKERETLSLDTDRIREKLEKTQVQLGRIQKERDQFSDELETL
KERSESAQTLLMKAARDREAMQTDLEVLKERYEKSHAIQQKLQMERDDAVTEVEILKEKL
DKALYASQKLIDEKDTSNKEFEKMLEKYDRAQNEIYRLQSRCDTAEADRARLEVEAERSG
LAASKAREDLRKLQDESTRLQEACDRAALQLSRAKECEDNARSELEHSRDRFDKLQTDIR
RAQGEKEHFQSELERVTYELERAHAAQTKASASVEAAKEEAAHYAVELEKMRDRYEKSQV
ELRKLQDTDTFGRETRRLKEENERLREKLDKTLMELETIRGKSQYESESFEKYKDKYEKI
EMEVQNMESKLHETSLQLELSKGEVAKMLANQEKQRSELERAHIEREKARDKHEKLLKEV
DRLRLQQSSVSPGDPVRASTSSSSALSAGERQEIDRLRDRLEKALQSRDATELEAGRLAK
ELEKAQMHLAKQQENTESTRIEFERMGAELGRLHDRLEKAEAEREALRQANRSGGAGAAP
HPQLEKHVQKLESDVKQLAMEREQLVLQLEKSQEILMNFQKELQNAEAELQKTREENRKL
RNGHQVPPVAAPPAGPSPAEFQAMQKEIQTLQQKLQESERALQAAGPQQAQAAAAAGASR
EEIEQWRKVIEQEKSRADMADKAAQEMHKRIQLMDQHIKDQHAQMQKMQQQMQQQQQAAQ
QAVQQAAQQQQSAAGAGGADPKELEKVRGELQAACTERDRFQQQLELLVTELEKSKMSNQ
EQAKQLQTAQQQVQQLQQQVQQLQQQMQQLQQAASAGAGATDVQRQQLEQQQKQLEEVRK
QIDNQAKATEGERKIIDEQRKQIDAKRKDIEEKEKKMAEFDVQLRKRKEQMDQLEKSLQT
QGGGAAAAGELNKKLMDTQRQLEACVKELQNTKEEHKKAATETERLLQLVQMSQEEQNAK
EKTIMDLQQALKIAQAKVKQAQTQQQQQQDAGPAGFLKSFF
Download sequence
Identical sequences A0A0B4K6V0
FBpp0293599 NP_001246230.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]