SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293601 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293601
Domain Number 1 Region: 560-768
Classification Level Classification E-value
Superfamily TPR-like 5.69e-34
Family Tetratricopeptide repeat (TPR) 0.00067
Further Details:      
 
Domain Number 2 Region: 723-902
Classification Level Classification E-value
Superfamily TPR-like 2.02e-23
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293601   Gene: FBgn0028481   Transcript: FBtr0305064
Sequence length 908
Comment pep:known chromosome:BDGP5:2L:922793:958098:1 gene:FBgn0028481 transcript:FBtr0305064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFTCLFCCSLAFVLYLNTLGAGFVYDDRRAILANADVSGGTPWQRSFSNDFWGTPLTDS
GSHGSWRPLCVLSFRLNYLIGGGFAPWGFHLVNNLLHCVATALVVRVARTLLASVWAVLA
AGALFAAHPIHTEAVAGVVGRADLAACVCYLLTYLSYLRHMRWRESGDPRQWLALGATLI
LAAAGLLCKETAITALLVCALFDVMRGLSGQVDKQRLRSVCIVLGALFCMAYCRLVIVPG
PQTAFSSADNPIARTPSAWTRLLTFLYLPVFNLRLLLQPNVLSFDWGMDALPRVTSLWDR
RNAQSACFYSVLVGVAWGSCRQLLSGSKEVTHCGVSSTFPQYHIQKVASRKSRSKRKRLA
NNTKYQAFEAAYHQQQQEALPCRDCNNNNSSGYVYEGSSPVAQAPAQAPHLVSSAFRGSR
SSSSCSNSTNSSSSSSSSSSSSSSSSSSLSGGFQCSSKDYALEGMSPANRHACVLIMSLS
FLALPFLPASNLLFYVGFVVAERLLYLPSVGFCLLVGYGVSKLMSCNQRTRNILLLSFSL
LLAAMSLRTLRRNADWRDEESLYRSAIAINPPKALGNLGSVLSSQGRYEEAKQVLQEAIR
FRPNMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAI
EILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQ
QREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMW
FKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYHRRAAELAPNDYTLVVAAATAMRLLD
RKVDAEMWYRKAVALRPGDAHAHTNLGAILHLLGRTNHAAASYKAALRLQPGDAITLGNL
AKLGVTNV
Download sequence
Identical sequences A8DYS8
NP_001097048.2.81976 FBpp0293601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]