SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293672 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293672
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000926
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000282
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000314
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000519
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000175
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 10264-10287
Classification Level Classification E-value
Superfamily DPY module 0.00000523
Family DPY module 0.001
Further Details:      
 
Domain Number 11 Region: 10599-10753
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000722
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 12 Region: 958-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000008
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 13 Region: 11337-11360
Classification Level Classification E-value
Superfamily DPY module 0.0000131
Family DPY module 0.0011
Further Details:      
 
Domain Number 14 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000132
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 9941-9964
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.00089
Further Details:      
 
Domain Number 16 Region: 9834-9857
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.001
Further Details:      
 
Domain Number 17 Region: 1334-1479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 18 Region: 10802-10825
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0012
Further Details:      
 
Domain Number 19 Region: 10909-10932
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0013
Further Details:      
 
Domain Number 20 Region: 915-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000028
Family EGF-type module 0.017
Further Details:      
 
Domain Number 21 Region: 9518-9541
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 22 Region: 9198-9221
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0015
Further Details:      
 
Domain Number 23 Region: 9729-9752
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0017
Further Details:      
 
Domain Number 24 Region: 12830-12853
Classification Level Classification E-value
Superfamily DPY module 0.0000418
Family DPY module 0.0011
Further Details:      
 
Domain Number 25 Region: 11767-11790
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0012
Further Details:      
 
Domain Number 26 Region: 12189-12212
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0013
Further Details:      
 
Domain Number 27 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000513
Family EGF-type module 0.025
Further Details:      
 
Domain Number 28 Region: 9626-9649
Classification Level Classification E-value
Superfamily DPY module 0.0000667
Family DPY module 0.0014
Further Details:      
 
Domain Number 29 Region: 10048-10071
Classification Level Classification E-value
Superfamily DPY module 0.0000824
Family DPY module 0.0014
Further Details:      
 
Domain Number 30 Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family EGF-type module 0.016
Further Details:      
 
Domain Number 31 Region: 12614-12637
Classification Level Classification E-value
Superfamily DPY module 0.0000863
Family DPY module 0.002
Further Details:      
 
Domain Number 32 Region: 12406-12429
Classification Level Classification E-value
Superfamily DPY module 0.0000994
Family DPY module 0.0013
Further Details:      
 
Weak hits

Sequence:  FBpp0293672
Domain Number - Region: 11871-11894
Classification Level Classification E-value
Superfamily DPY module 0.000109
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 10484-10507
Classification Level Classification E-value
Superfamily DPY module 0.00011
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 13028-13050
Classification Level Classification E-value
Superfamily DPY module 0.000112
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11976-11999
Classification Level Classification E-value
Superfamily DPY module 0.000118
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 9304-9326
Classification Level Classification E-value
Superfamily DPY module 0.000123
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11017-11040
Classification Level Classification E-value
Superfamily DPY module 0.000127
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 9410-9433
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 12936-12958
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12512-12535
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12086-12109
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10158-10181
Classification Level Classification E-value
Superfamily DPY module 0.000248
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11125-11148
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 12720-12743
Classification Level Classification E-value
Superfamily DPY module 0.000471
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 10374-10397
Classification Level Classification E-value
Superfamily DPY module 0.000523
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 11657-11680
Classification Level Classification E-value
Superfamily DPY module 0.00085
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00091
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 11087-11120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000955
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 12295-12318
Classification Level Classification E-value
Superfamily DPY module 0.0011
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 11247-11395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00124
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 13475-13498
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 13605-13628
Classification Level Classification E-value
Superfamily DPY module 0.00144
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 9795-9829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 11939-11971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00158
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 9090-9113
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 12049-12081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00213
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 13094-13117
Classification Level Classification E-value
Superfamily DPY module 0.00222
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 9586-9619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 9693-9724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00466
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 13216-13239
Classification Level Classification E-value
Superfamily DPY module 0.00484
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 8770-8806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00722
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 10056-10216
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 11441-11464
Classification Level Classification E-value
Superfamily DPY module 0.00889
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 14251-14273
Classification Level Classification E-value
Superfamily DPY module 0.00981
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 10978-11012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 8989-9010
Classification Level Classification E-value
Superfamily DPY module 0.0112
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 11510-11543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 12897-12929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0163
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 9313-9469
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0215
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 9051-9084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0247
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 12626-12779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0282
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 11732-11762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 10010-10043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0298
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 11574-11715
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0306
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 12576-12609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0326
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 13416-13437
Classification Level Classification E-value
Superfamily DPY module 0.0353
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 12790-12818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 14504-14526
Classification Level Classification E-value
Superfamily DPY module 0.0379
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 8902-8935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0396
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 14442-14462
Classification Level Classification E-value
Superfamily DPY module 0.0418
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 11194-11227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 14325-14345
Classification Level Classification E-value
Superfamily DPY module 0.051
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 12198-12356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0526
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 8620-8779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0534
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 10870-10903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0541
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 13768-13811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0628
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number - Region: 1828-1946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0659
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 12151-12183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 13998-14020
Classification Level Classification E-value
Superfamily DPY module 0.0693
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 2498-2519
Classification Level Classification E-value
Superfamily DPY module 0.0706
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 13158-13178
Classification Level Classification E-value
Superfamily DPY module 0.0785
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 9482-9513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0788
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 791-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0863
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 10226-10258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0977
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 1570-1602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293672   Gene: FBgn0053196   Transcript: FBtr0305142
Sequence length 15105
Comment pep:known chromosome:BDGP5:2L:4477462:4591963:-1 gene:FBgn0053196 transcript:FBtr0305142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQ
AHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQ
RIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPET
ETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTL
PSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPT
TLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSA
SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYS
DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE
VRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSAD
RTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDF
TTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPT
TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECT
RDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESP
ETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP
SPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTS
PSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSES
PETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAST
PSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETT
TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSE
SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPI
GSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDR
TSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTT
QPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTT
LPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVT
LEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSES
PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTG
GQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTI
RVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSE
IPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDA
LETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTV
FNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTF
NNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKNS
TSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTTTTSSTSTESSTITSATNQTS
KNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPK
MKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCA
PNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTA
KSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATN
AVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQED
SCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQC
GAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPK
GLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCD
PSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHP
VCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGC
REPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSK
ACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPC
GRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICG
INAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGV
ALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPV
CACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPH
IGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIA
CNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECA
PNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVP
KNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQN
PCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAV
CTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAEC
TVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVG
YFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEG
NPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN
QDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLD
PPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINMK
CRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCG
LFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNA
RCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSS
GAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPV
CMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPY
VECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVG
CHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSS
SECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPI
THDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACI
NLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPC
GANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGV
SAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVC
SCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCP
AGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPN
CRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCN
PQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSR
DKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDE
NPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDP
CPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNS
KCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCT
VIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCAC
LPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFD
GYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPEC
VVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEV
KNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQER
CVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCG
PHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNIC
GDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQ
AVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPIC
TCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFI
GAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDP
FVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADC
PRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIE
ACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPC
AAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPN
SICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAEC
RVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEY
QGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTG
DPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTV
NAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPP
PGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQA
CIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDP
CDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVC
GQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVC
ACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCN
TGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCR
PECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKE
QDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECP
ANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPC
YPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDAC
VGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYN
GAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSP
YAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCV
CNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARC
HCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCP
AGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTL
PLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCAR
SAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAE
ANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCT
HGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCR
PVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLAC
INERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGC
QHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEV
DVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGN
PQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGF
SGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVG
LEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPD
QLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVP
VRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVC
QVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAE
CYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRA
ECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPC
QRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNS
VCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCI
PACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCN
DPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLR
GECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVR
DVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLG
YRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQC
QCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKD
EECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQAYNIKC
VYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKLQVDV
EPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAF
KFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLR
EEITISSNAILTFEKRSGQGLNDANIKPAAQRVEDICVSMVGLIIALVITALLALVAVAV
AVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9NCR4
FBpp0293672 NP_001245876.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]