SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293675 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293675
Domain Number 1 Region: 210-340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 2 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 5979-6002
Classification Level Classification E-value
Superfamily DPY module 0.0000017
Family DPY module 0.00085
Further Details:      
 
Domain Number 4 Region: 3205-3228
Classification Level Classification E-value
Superfamily DPY module 0.00000275
Family DPY module 0.001
Further Details:      
 
Domain Number 5 Region: 3540-3694
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000581
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 4278-4301
Classification Level Classification E-value
Superfamily DPY module 0.00000706
Family DPY module 0.0011
Further Details:      
 
Domain Number 7 Region: 5774-5934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000863
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 2882-2905
Classification Level Classification E-value
Superfamily DPY module 0.00000955
Family DPY module 0.00089
Further Details:      
 
Domain Number 9 Region: 2775-2798
Classification Level Classification E-value
Superfamily DPY module 0.0000106
Family DPY module 0.001
Further Details:      
 
Domain Number 10 Region: 3743-3766
Classification Level Classification E-value
Superfamily DPY module 0.0000107
Family DPY module 0.0012
Further Details:      
 
Domain Number 11 Region: 3850-3873
Classification Level Classification E-value
Superfamily DPY module 0.0000115
Family DPY module 0.0013
Further Details:      
 
Domain Number 12 Region: 2459-2482
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0013
Further Details:      
 
Domain Number 13 Region: 2139-2162
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0015
Further Details:      
 
Domain Number 14 Region: 2670-2693
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0017
Further Details:      
 
Domain Number 15 Region: 6304-6327
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0011
Further Details:      
 
Domain Number 16 Region: 4708-4731
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0012
Further Details:      
 
Domain Number 17 Region: 5130-5153
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0013
Further Details:      
 
Domain Number 18 Region: 2567-2590
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0014
Further Details:      
 
Domain Number 19 Region: 2989-3012
Classification Level Classification E-value
Superfamily DPY module 0.0000432
Family DPY module 0.0014
Further Details:      
 
Domain Number 20 Region: 5555-5578
Classification Level Classification E-value
Superfamily DPY module 0.0000458
Family DPY module 0.002
Further Details:      
 
Domain Number 21 Region: 5347-5370
Classification Level Classification E-value
Superfamily DPY module 0.0000523
Family DPY module 0.0013
Further Details:      
 
Domain Number 22 Region: 3425-3448
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0015
Further Details:      
 
Domain Number 23 Region: 4812-4835
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0019
Further Details:      
 
Domain Number 24 Region: 6502-6524
Classification Level Classification E-value
Superfamily DPY module 0.0000589
Family DPY module 0.0014
Further Details:      
 
Domain Number 25 Region: 4917-4940
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0016
Further Details:      
 
Domain Number 26 Region: 2245-2267
Classification Level Classification E-value
Superfamily DPY module 0.0000654
Family DPY module 0.0014
Further Details:      
 
Domain Number 27 Region: 4174-4197
Classification Level Classification E-value
Superfamily DPY module 0.0000654
Family DPY module 0.0015
Further Details:      
 
Domain Number 28 Region: 3958-3981
Classification Level Classification E-value
Superfamily DPY module 0.0000667
Family DPY module 0.0017
Further Details:      
 
Domain Number 29 Region: 2351-2374
Classification Level Classification E-value
Superfamily DPY module 0.0000745
Family DPY module 0.0015
Further Details:      
 
Weak hits

Sequence:  FBpp0293675
Domain Number - Region: 6410-6432
Classification Level Classification E-value
Superfamily DPY module 0.000102
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 5453-5476
Classification Level Classification E-value
Superfamily DPY module 0.000112
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 5027-5050
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 6193-6216
Classification Level Classification E-value
Superfamily DPY module 0.000127
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 3099-3122
Classification Level Classification E-value
Superfamily DPY module 0.000128
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 4066-4089
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 5661-5684
Classification Level Classification E-value
Superfamily DPY module 0.000248
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 3315-3338
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 4188-4337
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000324
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 4598-4621
Classification Level Classification E-value
Superfamily DPY module 0.000445
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 5236-5259
Classification Level Classification E-value
Superfamily DPY module 0.000575
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 6949-6972
Classification Level Classification E-value
Superfamily DPY module 0.000693
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 7079-7102
Classification Level Classification E-value
Superfamily DPY module 0.000759
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 2031-2054
Classification Level Classification E-value
Superfamily DPY module 0.000994
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 6568-6591
Classification Level Classification E-value
Superfamily DPY module 0.00118
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 6101-6252
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0018
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 6690-6713
Classification Level Classification E-value
Superfamily DPY module 0.00248
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 168-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00401
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 4881-4912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2737-2773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00454
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 4382-4405
Classification Level Classification E-value
Superfamily DPY module 0.00471
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 7725-7747
Classification Level Classification E-value
Superfamily DPY module 0.0051
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 1561-1719
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00549
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 1930-1951
Classification Level Classification E-value
Superfamily DPY module 0.00589
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 6086-6109
Classification Level Classification E-value
Superfamily DPY module 0.00719
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 2528-2560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00802
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 1715-1754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0108
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 3967-4121
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0116
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 6049-6084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 5567-5720
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0149
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 2998-3157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0149
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 4515-4656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0165
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 6890-6911
Classification Level Classification E-value
Superfamily DPY module 0.0183
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 7978-8000
Classification Level Classification E-value
Superfamily DPY module 0.0196
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 7916-7936
Classification Level Classification E-value
Superfamily DPY module 0.0222
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 4453-4484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0255
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 7799-7819
Classification Level Classification E-value
Superfamily DPY module 0.0275
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 5729-5761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 2254-2410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 7472-7494
Classification Level Classification E-value
Superfamily DPY module 0.0366
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 4990-5025
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0384
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 6632-6652
Classification Level Classification E-value
Superfamily DPY module 0.0418
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 3920-3956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 7242-7285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 1344-1364
Classification Level Classification E-value
Superfamily DPY module 0.0562
Family DPY module 0.003
Further Details:      
 
Domain Number - Region: 1221-1243
Classification Level Classification E-value
Superfamily DPY module 0.0654
Family DPY module 0.003
Further Details:      
 
Domain Number - Region: 7405-7428
Classification Level Classification E-value
Superfamily DPY module 0.085
Family DPY module 0.0039
Further Details:      
 
Domain Number - Region: 1490-1511
Classification Level Classification E-value
Superfamily DPY module 0.0876
Family DPY module 0.0034
Further Details:      
 
Domain Number - Region: 7290-7310
Classification Level Classification E-value
Superfamily DPY module 0.0902
Family DPY module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293675   Gene: FBgn0053196   Transcript: FBtr0305145
Sequence length 8579
Comment pep:known chromosome:BDGP5:2L:4479471:4591963:-1 gene:FBgn0053196 transcript:FBtr0305145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEAACVLDTECGAFEVCQGGQCFNP
CLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLP
VCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDK
CVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLA
CFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPP
ELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNED
CQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTGCRT
DLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPER
CHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERGACIAGC
KSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFE
CRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPL
EGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACH
VLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCY
SDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPK
CVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVC
ICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSC
EVQNHKPVCICMRDCQPSISICLRDAGCPASQACRKLKCVDPCEFATCAPNSPCIVEDHK
PICKFCPAGFIADAKNGCQKEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVF
NHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKEPPGSPKTPEPCQSNNDCIESEACYM
GLCQDPCEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVT
EACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNED
CPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRS
DSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPN
PCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFC
LPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEP
INPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYV
AGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDP
TSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGN
PGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDC
GDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSR
DPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCL
DPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAE
CKRQHSGLACVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCR
VVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCL
PNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANF
EGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRP
ECTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKI
TERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSL
ACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNP
CGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGF
NAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAE
CSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSC
IESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYIN
CRPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACV
ERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPS
DRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIV
PPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCA
DPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNAL
CEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCA
VFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAV
CSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSC
SPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGR
APNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFS
ECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDC
SKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEP
CRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCP
GTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQC
RVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVV
NHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPE
YFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYT
GNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPE
CIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILL
EPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLA
CVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCN
PSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPG
ACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNS
HAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPI
CTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPT
CRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQ
LIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENND
DCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPP
LNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVD
PCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCG
PNAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEA
KCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQ
NNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKG
YEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPEC
VVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPI
AVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQ
ACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPC
GPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGL
NAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLA
VCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICS
CPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFI
GAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDP
FVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLST
DCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDP
CQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCP
GACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKV
LNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANH
QPICTCDVGYTGDPFTGCQKEQAPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVG
TPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDAL
TRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTI
NAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPP
PKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCV
DPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGAN
AQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVC
QAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECR
CLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPV
GMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPY
EGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQ
CTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCA
KDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQ
PSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINH
KAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAP
QARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGT
GAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGA
QCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTH
PCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGG
NCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPT
TACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPY
DKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDC
ADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKP
QCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISR
NCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKG
FQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQ
RKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECT
VKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAEC
YGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAI
CQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSP
CHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHA
QCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCI
NPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQC
VNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACI
NEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCI
SDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINS
DCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDD
ECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPIC
ISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQC
DKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMV
IDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCG
VNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEP
GFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHP
KLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEIN
SAEIGDNLKLQVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEY
NPDTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDA
TAIATNSGVEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQRVEDICVSMVGLIIA
LVITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9NE82
FBpp0293675 NP_001245879.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]