SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293933 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293933
Domain Number 1 Region: 61-435
Classification Level Classification E-value
Superfamily L domain-like 7.18e-65
Family Ngr ectodomain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293933   Gene: FBgn0023095   Transcript: FBtr0305480
Sequence length 780
Comment pep:known chromosome:BDGP5:3L:13221792:13272742:1 gene:FBgn0023095 transcript:FBtr0305480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRRAITMSLAPHLGQAFSLCLCLCLCLVLATLPVALGLANCPNGCECDDDTLMVNCGE
GTLDVLPIALNPAIQRLVIKNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAK
LQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRIS
HIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLK
GLTRLDLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDF
EVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGG
LPHLSTVVLKANQLSSLDEGLVPWADLQTLDLSENPFECDCRLLWLRHLLVSRNASGQYA
PVICAYPTALRDLPLAHLAEPLLGCAHGAASKQAIIGILVVACAALITTLALVLYTCRHR
IREMLKGHSALGRKEREYQKTFSDEEYMSRPPPGGGGVHPAAGGYPYIAGNSRMIPVTEL
XLEAPPPPQLRGRGGGGGASTASGAVQQLQVPSAVDQASNSFAQLSHIHYMTNNGQQQQA
QQQQSTSKMHHSQQDMRLLACNGGKPLNATSLPRHRPPVVQESTLSHYSQPLANGIRLTQ
DHFNHNQNQSHNQHYGGVYAKPCDAMSEPGYIHNNSHYSLPLDHDLPPSPTPTPPPPALP
LRNGVGMALIHGNTTGRRSFNNNNNVSTLSNNNHHGIGGGVGVAVGGTVGNNNGSLRRYH
Download sequence
Identical sequences Q0E8F0
NP_001036604.2.81976 FBpp0075571 FBpp0293933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]