SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0294014 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0294014
Domain Number 1 Region: 33-181
Classification Level Classification E-value
Superfamily L domain-like 2.31e-30
Family Internalin LRR domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0294014   Gene: FBgn0028858   Transcript: FBtr0305563
Sequence length 182
Comment pep:known chromosome:BDGP5:2L:15979535:15981455:1 gene:FBgn0028858 transcript:FBtr0305563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMI
EKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVF
YISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPV
IR
Download sequence
Identical sequences Q9V3Q0
FBpp0080358 FBpp0294014 7227.FBpp0080358 FBpp0080358 FBpp0080358 NP_001246039.1.81976 NP_001285969.1.81976 NP_609776.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]