SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0294023 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0294023
Domain Number 1 Region: 269-299
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000902
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  FBpp0294023
Domain Number - Region: 627-667
Classification Level Classification E-value
Superfamily RING/U-box 0.000219
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number - Region: 76-99
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0235
Family CCCH zinc finger 0.005
Further Details:      
 
Domain Number - Region: 245-267
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0063
Further Details:      
 
Domain Number - Region: 108-145
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0589
Family CCCH zinc finger 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0294023   Gene: FBgn0004395   Transcript: FBtr0305572
Sequence length 672
Comment pep:known chromosome:BDGP5:3R:18977814:18983592:-1 gene:FBgn0004395 transcript:FBtr0305572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLANETNKLLLSSQQEKPNHYTYLKEFRVEQCQSFLQHKCNQHRPFVCFNWHFQNQRRRR
PVRKRDGTFNYSADNYCTKYDETTGICPEGDECPYLHRTAGDTERRYHLRYYKTCMCVHD
TDSRGYCVKNGLHCAFAHGMQDQRPPVYDIKELETLQNAESTLDSTNALNALDKERNLMN
EDPKWQDTNYVLANYKTEPCKRPPRLCRQGYACPQYHNSKDKRRSPRKYKYRSTPCPNVK
HGEEWGEPGNCEAGDNCQYCHTRTEQQFHPEIYKSTKCNDVQQAGYCPRSVFCAFAHVEP
CSIDEKTRDHTVYLNELISNAYPDLKAQDAFQRVDNLLNIDGNSTNKMLVDALENTTNFS
KFLSFSRPLDSRSCSMDDPRENSLSASLANTSLLTRSSAPINIPNTTLSNSINDFNSGSF
AVNIPSSSLTYSPTNHANLFNVDAFNYGGSNKLSNSLSATQNDSSLFFPSRIISPGFGDG
LSISPSVRISELNTIRDDINSSSVGNSLFENTLNTAKNAFSLQSLQSQNNSDLGRITNEL
LTKNAQIHKLNGRFEDMACKLKIAELHRDKAKQEAQEWKERYDLAQIQLNLPAELRDLSI
QKLKQLQSKLRTDLEEVDKVLYLENAKKCMKCEENNRTVTLEPCNHLSICNTCAESVTEC
PYCQVPVITTHT
Download sequence
Identical sequences A0A0B4K7D1
NP_001247254.1.81976 FBpp0294023 FBpp0083795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]