SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0296928 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0296928
Domain Number 1 Region: 56-115
Classification Level Classification E-value
Superfamily Chaperone J-domain 8.77e-18
Family Chaperone J-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0296928   Gene: FBgn0036173   Transcript: FBtr0305648
Sequence length 118
Comment pep:known chromosome:BDGP5:3L:11555773:11557412:1 gene:FBgn0036173 transcript:FBtr0305648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDP
KMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDKAK
Download sequence
Identical sequences M9NDP2 Q9VTJ8
FBpp0075829 FBpp0075829 FBpp0296928 FBpp0305417 NP_001246717.1.81976 NP_001261714.1.81976 NP_648475.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]