SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297127 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297127
Domain Number 1 Region: 4-276
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.72e-103
Family Inorganic pyrophosphatase 0.0000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297127   Gene: FBgn0016687   Transcript: FBtr0305985
Sequence length 290
Comment pep:known chromosome:BDGP5:2R:20446675:20448568:-1 gene:FBgn0016687 transcript:FBtr0305985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYETVEKGAKNSPSYSLYFKNKCGNVISPMHDIPLYANEEKTIYNMVVEVPRWTNAKM
EISLKTPMNPIKQDIKKGKLRFVANCFPHKGYIWNYGALPQTWENPDHIEPSTGCKGDND
PIDVIEIGYRVAKRGDVLKVKVLGTIALIDEGETDWKIIAIDVNDPLASKVNDIADVDQY
FPGLLRATVEWFKIYKIPDGKPENQFAFNGDAKNADFANTIIAETHKFWQNLVHQSPASG
SISTTNITNRNSEHVIPKEEAEKILAEAPDGGQVEEVSDTGKVHYIRSNL
Download sequence
Identical sequences A0A0B4K7G9
FBpp0297127 NP_001246494.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]