SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297152 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297152
Domain Number 1 Region: 1313-1527
Classification Level Classification E-value
Superfamily SET domain 1.05e-63
Family Histone lysine methyltransferases 0.001
Further Details:      
 
Domain Number 2 Region: 1851-1904
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000514
Family PHD domain 0.0061
Further Details:      
 
Weak hits

Sequence:  FBpp0297152
Domain Number - Region: 1732-1770
Classification Level Classification E-value
Superfamily Bromodomain 0.0102
Family Bromodomain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297152   Gene: FBgn0005386   Transcript: FBtr0306010
Sequence length 2226
Comment pep:known chromosome:BDGP5:3L:19583873:19591855:-1 gene:FBgn0005386 transcript:FBtr0306010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCSQNETAAAKVLETQRAQESGSENEETDSITDQSSQSKSIKSATQFSVQRSDTDGLRM
RISAIRPTLGVVATKKPPKSRKMSTQDTESGCSEAKNRAVSKKVKVKRKKLASSSGISKS
DKVSKSKKSQISAFSSDSEDDLPLKVHQQRAPRVLLSAIIQAAQSASKPTLDIGISSSDN
ELPNLVQAAIKRVESDTEDTTVEGSFRKAAKDKNLPQYQSTLLQDFMEKTQMLGQTVNAK
LAEEKVAKAKEETLVQTAVPRKRRGRPKKVVPTVPAPGNSGPAINESADSGVISTTSTTQ
STTPSPKMQNENAVPTGSLPIASSSKPKIDMAYLDKRMYATERVLYPPPRSKRRQNNKKT
ACSSSNKEELQLDPLWREIDVNKKFRLRSMSVGAASGTGASTTICSKVLAAKSGYVSDYG
SVRHQRSSHNHNSGYKSDASCKSRYSTKSCMSRRSRAKSCGYRSDCKESGKSGLRMRRKR
RASMLLKSSADDTVEDQDILQLAGLSLGQSSEESNEYISKPSLKSLPTTSASKKYGEINR
YVTTGQYFGRGGSLSATNPDNFISKMMNQRKETPAPSKSSCKIKSRRSSAASMCSSYVSG
VSRMRRRHRRKSFSHNKSLNIDSKLLTEIEIITSTFNSRCRIQDDRLTGSSGKEKLLADA
NKLQATLAAPSPAQQLTLNGGGPASTLSKPLKRGLKKRKLSEPLVDFAMLSASASGTPNG
SGSSNGNTKRRHKKSQSNDSSSPDDHKLPLKKRHYLLTPGERPPAEVAFANGKLNAEAWA
AAAAAAKSTASTKSQAQFNARSVKSALTPKKRHLLEQPTSVSGAGSSASNSPLRIVVDNN
SISGGKLLDISPSSLCSLKQQRRGGAAKQKVSAAKDLVQLQSPAGSYPPPGVFEPSVELE
IQIPLSKLNESVITKAEVESPLLSALDIKEDTKKEVGQRVVETLLHKTGGNLLLKRKRKK
INRTGFPTVRRKKRKVSVEQQTTAVIDEHEPEFDPDDEPLQSLRETRSSNNVNVQAAPNP
PLDCERVPQAGEARETFVARTNQKAPRLSVVALERLQRPQTPARGRPRGRKPKNREQAEA
APQPPPKSEPEIRPAKKRGRQPKQPVLEEPPPTPPPQQKKNKMEPNIRLPDGIDPNTNFS
CKIRLKRRKNLEAGTQPKKEKPVQPVTVEEIPPEIPVSQEEIDAEAEAKRLDSIPTEHDP
LPASESHNPGPQDYASCSESSEDKASTTSLRKLSKVKKTYLVAGLFSNHYKQSLMPPPAK
VNKKPGLEEQVGPASLLPPPPYCEKYLRRTEMDFELPYDIWWAYTNSKLPTRNVVPSWNY
RKIRTNVYAESVRPNLAGFDHPTCNCKNQGEKSCLDNCLNRMVYTECSPSNCPAGEKCRN
QKIQRHAVAPGVERFMTADKGWGVRTKLPIAKGTYILEYVGEVVTEKEFKQRMASIYLND
THHYCLHLDGGLVIDGQRMGSDCRFVNHSCEPNCEMQKWSVNGLSRMVLFAKRAIEEGEE
LTYDYNFSLFNPSEGQPCRCNTPQCRGVIGGKSQRVKPLPAVEAKPSGEGLSGRNGRQRK
QKAKKHAQRQAGKDISSAVAVAKLQPLSEKEKKLVRQFNTFLVRNFEKIRRCKAKRASDA
AATASSPALGTTNGDIPGRRPSTPSSPSLAAQISALCSPRNIKTRGLTQAVHDPELEKMA
KMAVVLRDICSAMETLKMSDLLTTVSSKKKKPIKTTLSGKLGSTAATSKVEFRSIQAQVE
QGHYKTPQEFDDHMQQLFVEAKQQHGDDEGKEKALQSLKDSYEQQKIASYVQLVEILGDS
ESLQSFKPKEVLSSEEEPGKIAVKKSPGAKERDSPIVPLKVTPPPLLPIEASPDEDVIRC
ICGLYKDEGLMIQCSKCMVWQHTECTKADIDADNYQCERCEPREVDREIPLEEFTEEGHR
YYLSLMRGDLQVRQGDAVYVLRDIPIKDESGKVLPTKKHTYETIGAIDYQECDIFRVEHL
WKNELGKRFIFGHHFLRPHETFHEPSRRFYPNEVVRVSLYEVVPIELVIGRCWVLDRTTF
CKGRPMECNDEDHCYICELRVDKTARFFSKAKANHPACTKSYAFRKFPEKIKISKSYAPH
DVDPSLLKTRKQKTELDVGAGPTTMHKVSGRQEQHQAKMVGRKPRGISAPADATAVHVVT
PVAPNKQMLKKRKSRLENVLITMKLKCLDAQTAQEQPIDLSYLLSGRGARQRKTQQSSSS
STANST
Download sequence
Identical sequences Q9VW15
FBpp0297151 FBpp0297152 FBpp0297151 NP_001246834.1.81976 NP_524160.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]