SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297232 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297232
Domain Number 1 Region: 65-348
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.94e-72
Family FCH domain 0.00000047
Further Details:      
 
Domain Number 2 Region: 581-642
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000341
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 409-480
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000994
Family HR1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297232   Gene: FBgn0035533   Transcript: FBtr0306095
Sequence length 646
Comment pep:known chromosome:BDGP5:3L:4323530:4363974:-1 gene:FBgn0035533 transcript:FBtr0306095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKKLAQITKKKTVADLEAECVHSAIAFTCVRVCAKLLASGSSRSSSNNKLAESENSAQ
NSNNMSWGTELWDQNENLAIHTNRGIDALDKFANFLRDRVAIETEYAGKLRRLVKNYQPK
KKEEEDNEFTSVQAFRNLLKEVGDLAGQREVVSESLQLQIIAGVTLLSKTLREERKKCLS
DGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAVDSYKRADMDLNLSRAEVERYKNVMTS
KIQQSDDAKNEYANQLQKTNNLQQQHYSMLLPSVLNRLQELDEKRTRGFREFIVGAADVE
SSVAPIIARCMEGIVKAGESINEKEDTFKVIERYQSGFTPPRDIPFEDLSKCDPDSVQDS
HYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSNKNSLTADGQKEDFSDLPPNQRRKKLQ
AKIAELTQNIAQETKARDGLMKMKIVYEANSSLGNPMTVEGQLNESEHKLEKLKVDLKKY
QGFLEKASQVPTATSSPQASRNQLQNGHRTSRHSNGSADDHHDDGDDQPDDAGSLSSSSA
SPESGLGTSHTSLPGSGQGSANENAIGEDTYYETEVETLNPVGKCRALYPFEASSEGSIP
MSEGEELQVIEIDQGDGWTRVRRENNSNGWDEGFVPTSYIEITLYA
Download sequence
Identical sequences M9ND44
FBpp0297232 NP_001246621.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]