SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297289 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297289
Domain Number 1 Region: 32-98
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000759
Family Tachycitin 0.036
Further Details:      
 
Domain Number 2 Region: 120-179
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000022
Family Tachycitin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297289   Gene: FBgn0262854   Transcript: FBtr0306159
Sequence length 182
Comment pep:known chromosome:BDGP5:3L:21251120:21251858:1 gene:FBgn0262854 transcript:FBtr0306159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLALVLLAGLYILSDYFTSGQSYTYNADEICICSGHLVNDLVPDCEDCSGYYICGDGSY
EKVKCPQGLIFDIALNTCVLGQCPRFDGTCSANSTVPPPVTTTTTTAAPETIPPTPSGPC
DNDVTCQLQEKSIPHPTHCRNFYTCYGKCAVLGLCELGKWFDREGNVCNYSHKVTNCPAN
QD
Download sequence
Identical sequences C6SUT0
FBpp0297289 FBpp0297289 NP_001246864.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]