SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297300 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297300
Domain Number 1 Region: 73-212
Classification Level Classification E-value
Superfamily PX domain 0.000000000000209
Family PX domain 0.0088
Further Details:      
 
Weak hits

Sequence:  FBpp0297300
Domain Number - Region: 251-446
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000628
Family Arfaptin, Rac-binding fragment 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297300   Gene: FBgn0032005   Transcript: FBtr0306170
Sequence length 455
Comment pep:known chromosome:BDGP5:2L:8218071:8220741:-1 gene:FBgn0032005 transcript:FBtr0306170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGTDDSNLLNSPSTNNGATMEIASPTNPLATPPATGGAPAPSGATNGSGSATSPDSSS
SAPATPAVLGENALHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHD
RIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFK
KTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEI
LLSATVRDVNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLST
TEKGNVETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCL
AAYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEACEKFESMSACGKEELIGFRNRRVA
AFKKSLVELSELEIKHAKTQYEYLRQSLLALKEIA
Download sequence
Identical sequences A0A0J9QY14 M9NDI3
FBpp0297300 FBpp0297300 NP_001245939.1.81976 XP_016024114.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]