SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297427 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297427
Domain Number 1 Region: 577-613
Classification Level Classification E-value
Superfamily SAP domain 0.00000000504
Family SAP domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297427   Gene: FBgn0052296   Transcript: FBtr0306331
Sequence length 1495
Comment pep:known chromosome:BDGP5:3L:2717615:2766480:-1 gene:FBgn0052296 transcript:FBtr0306331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGEQRLHATFLGSSDDGNNSDCYDARQSPPKAIVDSSPLQPAMDKNKESLKVKLMVRR
PHSQLVEQGIIPSLKTSPAIHEQCKQLERAKTSDLLKAKIQQRPNREDLERLHILEEDEC
HIDPSLAEKQRMLKKARLADQLNSQIQHRPGPLELIKKNILHTEKPIEKIVKEGLVSFKA
TSEGLLTRPQHPHSYVTFDDDSLSSESDTRQTPPRLDEAMVATSSSPTDVLQAAAASAGI
VTMALTMPTAGQLVVTSPQILPQQQQPKAIVVPAPVPPPPPPPPPLPMASIIKVKQETAN
LYEELCQSVTGTTASPVNHLYSPCSLASSTSTLSPLSSIASPPPPPMTTTRLHLAPVSVK
SDAPGKDKNRKKSKSKPVSKARTIKFHEYKGPPSAAGQKQDQTQPEETSYQLMLEQQNCL
LKFLENLNKNQSIIPAPSAPGVMLPAAPGATNNSITVTTKTVPALASQSAPAPAPISLPN
TISITSSSGGAPLNFGDATMLTPTPAATPTPPTLSLIAAPQQQLQLHQQHQQLHQPTPVQ
HPPPLPSPALSVSSSIPPSPATSYAESTTSSITDLARLEKMKVSDLKQHLKRRNLPVSGP
KPHLIERLKPYLPLEPLDSNVTPAPTSNNSNTTPEVITISDAMDTSNCGLLEQPPPVTML
VSDASMEHEQMDVVQQQMDNTHPMTLQTILPPQPQTATIILTNEELLREQQRKIDELQRQ
LQRSQQELQKIRQRQQQQQHQQQQTVTAQVVNALPSQQITLITTTSNGPQQTLTVMPQQV
EKNFPAKVTVKATGGNSNHKVNGLQQQGSAAKKPASSNSNSNSNISSSNPPPINQKMVVK
QQLEAKIQKQKAAAAAAAQQQQQQQQQQQQQQQQQALQQQQQQQQQQQQVRLLTQKTQTV
FIPFNNNNHINNASAKTTTKKSNVPANNTNTTTATMMQAAKPAAVAAAAASPGNQHHNNL
GLLWNEGNQTILLLGLNDQHMTAHTLGNISLTATTTTTAAPPAATPVAASTIAPPKKILN
GHQRTNSLPSIVFPIETKSIITQQQLQQLQQQQQQQQQFQPVQQPKQQQLNQVDIKPAPA
PPPQYEEATKQLAASKAAALNGLLPLVKIKEEPVQSPAPSAAPLPQTAPLCKRKTASIKS
EQVSDVLDILIKQGELPESAALEPITPLTPLPELSMFNGATPTTAAGGASIVPLVPKLET
PVTPVQNLDVAMDTNVQHVGFASNQAPNHVFIESIDMASPLQTDSSAIDAESVAKTLDIF
LEQHHATPPPSTPPKSCHSGSEKPNSPDAKLNHFDEYELLELMSQQLEMDMGDDSSGYCH
ASAAKSSNNNGNLRRDLNPSLQPSINELLDASSPDNVLLNNNTGADVDFDADSFVAQLSQ
HVTGNGNSPGVNCNGSIESSSSAVNSHFGSHSTPMDCDDFESTLNSFMQAVTQPQAGQHV
EYATSTSMANGTGGGMGVDNGTGGAVDAFNASGDIFDLFNMDDYKMNWAAGDFTV
Download sequence
Identical sequences Q9VZY2
NP_001137878.2.81976 NP_001246580.1.81976 FBpp0297427 FBpp0305634 FBpp0305635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]