SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297428 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297428
Domain Number 1 Region: 883-919
Classification Level Classification E-value
Superfamily SAP domain 0.00000000626
Family SAP domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297428   Gene: FBgn0052296   Transcript: FBtr0306332
Sequence length 1801
Comment pep:known chromosome:BDGP5:3L:2719689:2730315:-1 gene:FBgn0052296 transcript:FBtr0306332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSHDAMHPLAKIFGAISPLAVRQFALLSPPVTKSTQSVDGGPASWRLTLDQDLIDTLK
GNFPSWFQGSAGGGGGAGGAASKQNPQQHNHQLAQQKHHQLVATSVIPITIDTKLAASNT
NTLQQHQQQTAILGHSSSSASPASSVSSNSSKKSISSSLSSCSSSSSNSSSCGSNHCNSK
SVSSGAKGAGSATASRFLNKSTSTSPTKSLSRTLKATQKPNGNHKVGQLVKSASLHSLSS
GSSGSSSGNSASGSSSLLATISTSPLTTVELISSAACSGLLATRLSGKDLEHSFQDIILL
HEAYDDMSEGEQRLHATFLGSSDDGNNSDCYDARQSPPKAIVDSSPLQPAMDKNKESLKV
KLMVRRPHSQLVEQGIIPSLKTSPAIHEQCKQLERAKTSDLLKAKIQQRPNREDLERLHI
LEEDECHIDPSLAEKQRMLKKARLADQLNSQIQHRPGPLELIKKNILHTEKPIEKIVKEG
LVSFKATSEGLLTRPQHPHSYVTFDDDSLSSESDTRQTPPRLDEAMVATSSSPTDVLQAA
AASAGIVTMALTMPTAGQLVVTSPQILPQQQQPKAIVVPAPVPPPPPPPPPLPMASIIKV
KQETANLYEELCQSVTGTTASPVNHLYSPCSLASSTSTLSPLSSIASPPPPPMTTTRLHL
APVSVKSDAPGKDKNRKKSKSKPVSKARTIKFHEYKGPPSAAGQKQDQTQPEETSYQLML
EQQNCLLKFLENLNKNQSIIPAPSAPGVMLPAAPGATNNSITVTTKTVPALASQSAPAPA
PISLPNTISITSSSGGAPLNFGDATMLTPTPAATPTPPTLSLIAAPQQQLQLHQQHQQLH
QPTPVQHPPPLPSPALSVSSSIPPSPATSYAESTTSSITDLARLEKMKVSDLKQHLKRRN
LPVSGPKPHLIERLKPYLPLEPLDSNVTPAPTSNNSNTTPEVITISDAMDTSNCGLLEQP
PPVTMLVSDASMEHEQMDVVQQQMDNTHPMTLQTILPPQPQTATIILTNEELLREQQRKI
DELQRQLQRSQQELQKIRQRQQQQQHQQQQTVTAQVVNALPSQQITLITTTSNGPQQTLT
VMPQQVEKNFPAKVTVKATGGNSNHKVNGLQQQGSAAKKPASSNSNSNSNISSSNPPPIN
QKMVVKQQLEAKIQKQKAAAAAAAQQQQQQQQQQQQQQQQQALQQQQQQQQQQQQVRLLT
QKTQTVFIPFNNNNHINNASAKTTTKKSNVPANNTNTTTATMMQAAKPAAVAAAAASPGN
QHHNNLGLLWNEGNQTILLLGLNDQHMTAHTLGNISLTATTTTTAAPPAATPVAASTIAP
PKKILNGHQRTNSLPSIVFPIETKSIITQQQLQQLQQQQQQQQQFQPVQQPKQQQLNQVD
IKPAPAPPPQYEEATKQLAASKAAALNGLLPLVKIKEEPVQSPAPSAAPLPQTAPLCKRK
TASIKSEQVSDVLDILIKQGELPESAALEPITPLTPLPELSMFNGATPTTAAGGASIVPL
VPKLETPVTPVQNLDVAMDTNVQHVGFASNQAPNHVFIESIDMASPLQTDSSAIDAESVA
KTLDIFLEQHHATPPPSTPPKSCHSGSEKPNSPDAKLNHFDEYELLELMSQQLEMDMGDD
SSGYCHASAAKSSNNNGNLRRDLNPSLQPSINELLDASSPDNVLLNNNTGADVDFDADSF
VAQLSQHVTGNGNSPGVNCNGSIESSSSAVNSHFGSHSTPMDCDDFESTLNSFMQAVTQP
QAGQHVEYATSTSMANGTGGGMGVDNGTGGAVDAFNASGDIFDLFNMDDYKMNWAAGDFT
V
Download sequence
Identical sequences FBpp0297428 FBpp0288506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]