SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297447 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297447
Domain Number 1 Region: 117-168
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000942
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 2 Region: 163-219
Classification Level Classification E-value
Superfamily WWE domain 0.000000000366
Family WWE domain 0.0012
Further Details:      
 
Weak hits

Sequence:  FBpp0297447
Domain Number - Region: 312-347
Classification Level Classification E-value
Superfamily WWE domain 0.000235
Family WWE domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297447   Gene: FBgn0036897   Transcript: FBtr0306354
Sequence length 365
Comment pep:known chromosome:BDGP5:3L:19633459:19635916:-1 gene:FBgn0036897 transcript:FBtr0306354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQRSTEQIAASNNNTSDVIALDDDEDTDVQFVAALRPTAPVIDLCVSPSTSAAAAAAA
AAAAHSGGGSGEDPAVGSASGAAASDTDSLASSPDEGALATGVDAAAAVSGEDSPSAAAA
ALECPICLQTCIHPARLPCGHIFCFLCVKGVAYKNRRCAMCRREIPAEFLDHPQLVNGIE
DICTTRATEDGFQWYYEGRNGGWWAYDSRTNADIEIAYAGFEIFKADNPELAPLFDRDCP
NPINHYCLCDENIIFYNADSEIVIYPTIIRSSGQGAPASSENNGRDSPALSLDDIMSLDP
DELNIIRPHPCTLPIQICGRMYIIDFLQNLQYLRLTPEKSRNIMRCKSTDDVSGGMRGVA
GLSQN
Download sequence
Identical sequences B7Z083
NP_001137980.2.81976 FBpp0297447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]