SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297491 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297491
Domain Number 1 Region: 32-310
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.03e-69
Family FCH domain 0.000000746
Further Details:      
 
Domain Number 2 Region: 563-624
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000328
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 371-442
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000955
Family HR1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297491   Gene: FBgn0035533   Transcript: FBtr0306533
Sequence length 628
Comment pep:known chromosome:BDGP5:3L:4323530:4345497:-1 gene:FBgn0035533 transcript:FBtr0306533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCLLGYLNAAQRSLSESGVATILDPRDSHLEFWDQNENLAIHTNRGIDALDKFANFLRD
RVAIETEYAGKLRRLVKNYQPKKKEEEDNEFTSVQAFRNLLKEVGDLAGQREVVSESLQL
QIIAGVTLLSKTLREERKKCLSDGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAVDSYK
RADMDLNLSRAEVERYKNVMTSKIQQSDDAKNEYANQLQKTNNLQQQHYSMLLPSVLNRL
QELDEKRTRGFREFIVGAADVESSVAPIIARCMEGIVKAGESINEKEDTFKVIERYQSGF
TPPRDIPFEDLSKCDPDSVQDSHYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSNKNSL
TADGQKEDFSDLPPNQRRKKLQAKIAELTQNIAQETKARDGLMKMKIVYEANSSLGNPMT
VEGQLNESEHKLEKLKVDLKKYQGFLEKASQVPTATSSPQASRNQLQNGHRTSRHSNGSA
DDHHDDGDDQPDDAGSLSRSDSEDNVAQIQNGHNNNNNGSSASPESGLGTSHTSLPGSGQ
GSANENAIGEDTYYETEVETLNPVGKCRALYPFEASSEGSIPMSEGEELQVIEIDQGDGW
TRVRRENNSNGWDEGFVPTSYIEITLYA
Download sequence
Identical sequences M9NDH6
NP_001246618.1.81976 FBpp0297491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]