SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297492 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297492
Domain Number 1 Region: 31-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.89e-72
Family FCH domain 0.00000047
Further Details:      
 
Domain Number 2 Region: 547-608
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000315
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 375-446
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000916
Family HR1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297492   Gene: FBgn0035533   Transcript: FBtr0306534
Sequence length 612
Comment pep:known chromosome:BDGP5:3L:4322491:4364102:-1 gene:FBgn0035533 transcript:FBtr0306534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALLASGSSRSSSNNKLAESENSAQNSNNMSWGTELWDQNENLAIHTNRGIDALDKFAN
FLRDRVAIETEYAGKLRRLVKNYQPKKKEEEDNEFTSVQAFRNLLKEVGDLAGQREVVSE
SLQLQIIAGVTLLSKTLREERKKCLSDGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAV
DSYKRADMDLNLSRAEVERYKNVMTSKIQQSDDAKNEYANQLQKTNNLQQQHYSMLLPSV
LNRLQELDEKRTRGFREFIVGAADVESSVAPIIARCMEGIVKAGESINEKEDTFKVIERY
QSGFTPPRDIPFEDLSKCDPDSVQDSHYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSN
KNSLTADGQKEDFSDLPPNQRRKKLQAKIAELTQNIAQETKARDGLMKMKIVYEANSSLG
NPMTVEGQLNESEHKLEKLKVDLKKYQGFLEKASQVPTATSSPQASRNQLQNGHRTSRHS
NGSADDHHDDGDDQPDDAGSLSSSSASPESGLGTSHTSLPGSGQGSANENAIGEDTYYET
EVETLNPVGKCRALYPFEASSEGSIPMSEGEELQVIEIDQGDGWTRVRRENNSNGWDEGF
VPTSYIEITLYA
Download sequence
Identical sequences M9NE16
NP_001246619.1.81976 NP_001246620.1.81976 FBpp0297231 FBpp0297492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]