SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297503 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297503
Domain Number 1 Region: 22-551
Classification Level Classification E-value
Superfamily TPR-like 1.4e-151
Family HAT/Suf repeat 0.00000000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297503   Gene: FBgn0003559   Transcript: FBtr0306545
Sequence length 733
Comment pep:known chromosome:BDGP5:XHet:75686:80010:1 gene:FBgn0003559 transcript:FBtr0306545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARDLIKVDIEWGMERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVN
VFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHK
EKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTP
IVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPP
TLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQ
FLDTSARVLTEKGDVQAAKIFADECANILERSINGVLNRNALLYFAYADFEEGRLKYEKV
HTMYNKLLQLPDIDPTLVYVQYMKFARRAEGIKSARSIFKKAREDVRSRYHIFVAAALME
YYCSKDKEIAFRIFELGLKRFGGSPEYVMCYIDYLSHLNEDNNTRVLFERVLSSGGLSPH
KSVEVWNRFLEFESNIGDLSSIVKVERRRSAVFENLKEYEGKETAQLVDRYKFLDLYPCT
STELKSIGYAENVGIILNKVGGGAQSQNTGEVETDSEATPPLPRPDFSQMIPFKPRPCAH
PGAHPLAGGVFPQPPALAALCATLPPPNSFRGPFVSVELLFDIFMRLNLPDSAPQPNGDN
ELSPKIFDLAKSVHWIVDTSTYTGVQHSVTAVPPRRRRLLPGGDDSDDELQTAVPPSHDI
YRLRQLKRFAKSN
Download sequence
Identical sequences NP_001104479.1.81976 NP_001104480.2.81976 FBpp0112456 FBpp0297503 FBpp0112456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]