SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297559 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0297559
Domain Number - Region: 18-46
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0502
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297559   Gene: FBgn0261642   Transcript: FBtr0306604
Sequence length 803
Comment pep:known chromosome:BDGP5:2R:13153023:13252891:1 gene:FBgn0261642 transcript:FBtr0306604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYD
SIKGRCNRDKPPCKYFHPPQHLKDQLLINGRNHLALKNALMQQMGIAPGQPVISGQVPAV
ATNPYLTGIPANSYSPYYTTGHLVPALLGPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEM
DVKTVGSFYYDNFQFSGMVPFKRPAAEKSGIPVYQPGATAYQQLMQPYVPVSCIINAVMA
STNITSSATTTASSSLLSALGTPPTTTTTAITNPNDSDNDSDRNQDHDKNHDSTADGEAD
NADRNDAIDQVSNQDNSDQVNLNQNQQNSSPAKDCNTTRTISPNPQDTAATAATATETDT
LDTESAAAAAAATSATHPPGDTPPPCQRSPQGDSLLPLPNGLGDNNNYLSYINNNLNNGQ
LKSANPEELNGGDLESSSNNAAAAAAASASASRNYAKQNGEGYSRYMVNGHSTGILPTPT
TSAPAVSYQAQAQAQAQAQVQAQAQAQAQVQAQTQQRINYAMSAYGNLYSHYGAPTSAMV
SLPSSTPSYAQAQMQQQQQQAQAQAQAQAQAHAVYAQQAYAAYAAAGLAPQATATGSYYA
DPAALAKEVAQKNYAMKLASAGTKPGVSSAAAAYTGLTLNKSYVAAAAGAQPVQPAQHQA
VSMATLLQMQAQAQAQAAQVQAQAQAQAQAQAQAQAQAQMRQLGSLPSSGLATPVPGTPV
RAPVGASQYQSATLLRAPSPMPYAQPQSYFYPGMMPTAAYAMPQTQAAAAQQYAAAAAAA
AAAQAGTPGSAMVLNPYKKMKTS
Download sequence
Identical sequences A0A0B4K835
NP_001246393.1.81976 FBpp0297559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]