SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297617 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297617
Domain Number 1 Region: 36-320
Classification Level Classification E-value
Superfamily L domain-like 2.04e-39
Family Ngr ectodomain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297617   Gene: FBgn0031100   Transcript: FBtr0306678
Sequence length 425
Comment pep:known chromosome:BDGP5:X:20181336:20186734:-1 gene:FBgn0031100 transcript:FBtr0306678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNSWLVLIIALSVVVCLWNSQQTETSKSCPAECICLSQTQVLCNTGGLEQIPLRQLPAT
VENLALTKNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQ
MVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSLTN
VGHLILPSGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVLLLTLQESDLGV
ICADAFTGLTQVETLQILNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGV
EHLQLVSNHFPCGCHIHTLLDGPLAEGAHNLTDFLQKNYCISPLEVNGRVMSELDIDSIG
RCSDQLTKGNLGSSAASLALGINSMLLIAVASCAEWRHVRLLANRLAQLLGHVAWRRRRK
RRKGN
Download sequence
Identical sequences Q9VR83
FBpp0297617 NP_001259742.1.81976 NP_001259743.1.81976 NP_001259744.1.81976 NP_608382.2.81976 XP_016022639.1.80810 XP_016022640.1.80810 XP_016022641.1.80810 FBpp0297617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]