SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297694 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297694
Domain Number 1 Region: 914-1119
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-44
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 2 Region: 1119-1316
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-37
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 1408-1585
Classification Level Classification E-value
Superfamily Fibronectin type III 6.83e-30
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 816-920
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 432-533
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1327-1410
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-20
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 340-425
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 716-820
Classification Level Classification E-value
Superfamily Immunoglobulin 2.63e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 9 Region: 533-624
Classification Level Classification E-value
Superfamily Immunoglobulin 6.42e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 632-726
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000263
Family I set domains 0.019
Further Details:      
 
Domain Number 11 Region: 262-346
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000139
Family I set domains 0.027
Further Details:      
 
Domain Number 12 Region: 38-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000288
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0297694
Domain Number - Region: 114-226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000312
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297694   Gene: FBgn0033159   Transcript: FBtr0306778
Sequence length 2036
Comment pep:known chromosome:BDGP5:2R:3207059:3269374:-1 gene:FBgn0033159 transcript:FBtr0306778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVPQSYTVNVMDESILRGNSAILKCHIPSFVADFIVVDSWVEDEE
RVIYPQEDIAESDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
ITEPIGSKAPAVPTGVLAFQQNVPIHSIFAMLCQAQAFPVPIYRWYKFIEGTTRKQAVVL
NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF
GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA
SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ
VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA
IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
VAKNQEGYSARGSLEVQVMVLPQITPFATGSQPTHLGQYITYQCTLTEGDLPLNIRWTFN
NQPLFNDDDQDILIAKMGRRSSVLTIESVADRHAGNYSCHGENAAGRATYSTQLRVIVPP
RWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTL
HVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEA
KGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNA
FGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASW
SEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQN
IKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNL
ELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGW
VSPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATT
AGGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAE
GAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKI
ASFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQ
DAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGY
TLHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQ
KPKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNY
VVLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGSGHGNVHTRIRLPA
WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG
ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNL
YEELKAPPVPMHGNHYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQ
TFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAP
EYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPY
DHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDH
GPRGNYGAVKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
Download sequence
Identical sequences A0A0B4K7I3
FBpp0297694 NP_001246173.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]