SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297711 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0297711
Domain Number - Region: 3-71
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0345
Family Seryl-tRNA synthetase (SerRS) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297711   Gene: FBgn0035578   Transcript: FBtr0306799
Sequence length 163
Comment pep:known chromosome:BDGP5:3L:4837791:4840108:-1 gene:FBgn0035578 transcript:FBtr0306799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPISAAVQRRRQLLRSVESLRGRVRQVLKCVINLHIEFLVLESDVAALLDEVREFNDD
HEEMQRLDRMIEALRDYSGPTICHEWPYPLIFKGTIDEAHVAQILNASELDLDTKLVKVS
GGRNCIHVESDVVTAQRRSRLLWFSRRSRGKRAERLKEPNPVV
Download sequence
Identical sequences M9NE27
FBpp0297711 FBpp0297711 NP_001246634.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]