SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297861 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297861
Domain Number 1 Region: 28-132,318-420
Classification Level Classification E-value
Superfamily Fibronectin type III 2.44e-37
Family Fibronectin type III 0.00066
Further Details:      
 
Domain Number 2 Region: 138-233
Classification Level Classification E-value
Superfamily Immunoglobulin 6.85e-22
Family I set domains 0.0068
Further Details:      
 
Domain Number 3 Region: 243-333
Classification Level Classification E-value
Superfamily Immunoglobulin 4.09e-20
Family I set domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297861   Gene: FBgn0035410   Transcript: FBtr0307018
Sequence length 1443
Comment pep:known chromosome:BDGP5:3L:3172817:3178580:-1 gene:FBgn0035410 transcript:FBtr0307018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNQPGKLHTHPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHD
GGSPITGYTVEHRRMGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDAS
ELSDPLTVTLQRNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFS
SRRTKIVNDNEASVLVIHQVALTDEGEIKCTATNRAGHVITKARLMVQAPPKIRLPRTYE
DGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLRED
RGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGN
YIVEYFRVGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSGESELLFIP
DPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQADASTGMSPKQSPSA
KRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSADSANKPTTDSSNPKLNLTLV
TTTLAPLDKSVPSPKAPRTPATSPLKLFNPKPSGAPKDRSPVQPKPQPLPTPPMETPDKA
SPNPKRSLSPPNKRQPPPLRKSPTPPEPIKVTPALLRSAEPVQLGVNQNVRRFSGQTLSP
ARNVPTLALAVASGVSAVIGEKLPTIEISAPPTPQEEEPPVLERSPSPEPAPKSQSNARR
FSRSADKHDDVHTSNEFMLVVFDKNSKVKDKDKQDSFELDLEDAIQPPPISISAPDLAFL
EFTNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQASKSRKTSRDKLVTPVPHQTPAN
LRKRLGSISEAERLSFERRSEMRRQSADVVSISRKWDSRENVNEMGNLTRIHTTGQLPFE
TRKDLRESEAEEEHEEGEEEHLTESTADDSEDMDLDYDEDLDVDYPPQKKLQQQSSNDLG
SDYTESTASSEQDSIEKFKMELLARTRSPSPRDLETYHPRTMGAGTFTPYRAPTPEQAAV
VLNRPVPLPSPDFVPKPILKRSSNEHMEQAVSPLPSSFASEAPTIIVPPTATVANSNPST
LKMDLAKGIKSFFSRDKRSATEKNTEANEEISNPLERTNAAAIAADLEVKRKAKEEEELR
RKEEERLMQEEAHAAVDHYSDLVKEVGSSHKYHTPLYLDRDELKRAAAKAAAETDEEDML
THAEELKKRRATGGSEDLFLAPPVVRERRLSISEREQLVHVRDAASSLAFHRSPEKPESD
QEHESPKSQQDEEPEYPTVLVVPPPKSKNKNESETESVMSEMVEARPDARGRTRLVKVKR
VIRRRVPSSTRSRDASLTRPAIAEVEGSQQTSLVLSAADRDLLQKAATLAILQSEEQAHE
KVRSALSYCTDLVLFLVACYVYLFKDARLVLPILGLIIYRQLGEAVRGYVPGWLRRRFTG
NGS
Download sequence
Identical sequences Q9VZT8
NP_647779.2.81976 FBpp0297861 FBpp0297861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]