SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297896 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297896
Domain Number 1 Region: 23-64
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000376
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297896   Gene: FBgn0085318   Transcript: FBtr0307053
Sequence length 114
Comment pep:known chromosome:BDGP5:3R:19332630:19333203:-1 gene:FBgn0085318 transcript:FBtr0307053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSLIFCIPQPVEQYKSDISADNEQRYPHHISCGHSFCSACLKKYLELGRDSRCPLCRRD
FRADIQPSLSNNSAEEVESLPGTEMDTLVLTLSEQECWFFEQLYRDVELTSRRD
Download sequence
Identical sequences A0A0B4K6E5
FBpp0297896 NP_001247265.1.81976 FBpp0297897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]