SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297917 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297917
Domain Number 1 Region: 830-978
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.19e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0089
Further Details:      
 
Domain Number 2 Region: 325-436
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1297-1445
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.63e-23
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0052
Further Details:      
 
Domain Number 4 Region: 209-320
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 5 Region: 15-172
Classification Level Classification E-value
Superfamily C-type lectin-like 9.97e-22
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 6 Region: 2563-2772
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.42e-19
Family Laminin G-like module 0.037
Further Details:      
 
Domain Number 7 Region: 436-553
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-18
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 8 Region: 674-745
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 9 Region: 2204-2334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000126
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 1050-1114
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000736
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 11 Region: 3200-3348
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000759
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 12 Region: 2059-2096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000347
Family EGF-type module 0.008
Further Details:      
 
Domain Number 13 Region: 166-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 2174-2217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000102
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 15 Region: 612-675
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000167
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 16 Region: 728-792
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000222
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 17 Region: 2368-2411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000281
Family EGF-type module 0.005
Further Details:      
 
Domain Number 18 Region: 1856-1987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000528
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 2481-2559,3112-3180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000058
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 20 Region: 982-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000801
Family EGF-type module 0.026
Further Details:      
 
Domain Number 21 Region: 2329-2374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000766
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 22 Region: 2413-2445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family EGF-type module 0.019
Further Details:      
 
Domain Number 23 Region: 2024-2065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000132
Family EGF-type module 0.018
Further Details:      
 
Domain Number 24 Region: 786-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000182
Family EGF-type module 0.014
Further Details:      
 
Domain Number 25 Region: 551-623
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000278
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 26 Region: 2449-2485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000354
Family EGF-type module 0.022
Further Details:      
 
Domain Number 27 Region: 2146-2182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000783
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 28 Region: 1186-1254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000025
Family Complement control module/SCR domain 0.006
Further Details:      
 
Domain Number 29 Region: 2097-2141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000398
Family EGF-type module 0.06
Further Details:      
 
Weak hits

Sequence:  FBpp0297917
Domain Number - Region: 1250-1296
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000681
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number - Region: 3404-3443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000683
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 3372-3409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00709
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 2883-2938
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.075
Family Complement control module/SCR domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297917   Gene: FBgn0031879   Transcript: FBtr0307074
Sequence length 3589
Comment pep:known chromosome:BDGP5:2L:6972828:7010312:-1 gene:FBgn0031879 transcript:FBtr0307074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSTAANSHWLAALLSSLLLLNLLHLIGADEAFSCPNGWELRGLNCYKYFNIKHSWDKS
AELCRRYGAELVAIDSYAENNETLAIARASDPNQRASDKYWLGLASLDDLRTNTLESASG
ALISQYSGYWSLHQPNAESGECVAAAFAGKSQSWDLGTCESLLPFMCRAQACPQGSLHCA
NGKCINQAFKCDGSDDCGDGTDELDCPAQCHYHMQSGGDVIETPNYPHKYGALSKCKWTL
EGPLGSNIILQFQDFETEKTFDTVQILVGGRTEDKSVSLATLSGKQDLTTQPFVSASNFM
IVKFTTDGSVERKGFRATWKTEAKNCGGTLKATLQRQILTSPNYPKQYPGGLECLYVIKA
QPGRIISIEVDDLDIADGRDFLMIRDGESPMSRTIAKLTGKTAQNNRVIISTGNALYLYF
KSSLGEAGKGFSLRYIQGCKATITARNGTVTSPAFGLADYPKNQECYFTIRNNARAPLSL
KFDKFTVHKSDNVQVFDGSSTSGLRLHSGNGFTGPAAPKLTLTASSGEMLIKFTSDALHN
AAGWSATFSADCPELQPGIGALASSRDTAFGTLVSFTCPIGQEFATGKTRLVTECLRGGN
WSVSYIPKCQEVYCGPVPQIDNGFSIGSSNVTYRGIAMYQCYAGFAFASGAPIEKISCLP
DGRWERQPHCMASQCAALPEVAHANVTLLNGGGRSYGTIVQYECEPGYERNGHPVLTCMS
NGTWSGDVPRCTRKRCFEFPTIANGFVVDSTRAYLFGDEARVQCFKGYKLIGSNIMRCSE
AQKFEQPPTCEDINECSSSQCDLTTTECQNTNGSFHCQCRTGFTATTECRPVGDLGLGNG
GIPDDSITTSVSEPGYSKEQLRLNTNGWCGGSSEPGANWILIDLKAPTILRGFRTMSVQR
PDGNVAFSSAVRLQYTNDLTDVFKDYANPDGTAVEFRILEPTLSILNLPLPIEARYIRFR
IQDYVGAPCLRMELMGCTRLDCVDINECSKNNGGCDQKCINSPGGFACGCNTGYQLYTSN
GTAGYHIERSESGERDGDTYQRNKTCVPLMCPELEAPENGQLLSDKNDYHFGDVVRFQCH
FGYIMSGSSAALCLSSGQWNASVPECNYAKCVSLPDDKLEGLTVARPDPESVLVPFRDNV
TITCGSPGRQLRATASSGFRQCVYDPKPGLPDYWLSGMQPSCPRVDCYSPMPTPGAEYGQ
FVDTRYQSSFFFGCQNTFKLAGQTGRHDNVVRCGADGIWDFGDLRCEGPVCEDPGRPADG
RQIARSYEQSSEVYFGCNRPGYILINPRPITCIREPECKVIKPLGLSSGRIPDSAINATS
ERPNYEAKNIRLNSATGWCGKQEAFTYVSVDLGQIYRVKAILVKGVVTNDIVGRPTEIRF
FYKQAESENYVVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSYMDNACLKFE
LMGCEEPKQEPLLGYDYGYSPCVDNEPPIFQNCPQQPIVVRRDENGGVLPVNFTEPTAVD
NSGSIARLEIKPQNFRTPSYIFKDTVVKYVAFDYDGNVAICEINITVPDVTPPLLQCPQS
YVIELVDRQDSYTVNFNDTRKRIKTSDDTGDVRLQFSPESANIKIGNFENVTVTATDKYN
NRAACHFQVSVKASPCVDWELQPPANGAINCLPGDRGIECIATCKPGFRFTDGEPLKTFS
CETSRLWRPTSVVPDCVSENTEQAAYHVTASITYRANGAVAQSCLGQYQEVLAQHYGGLN
QLLSQRCSAVNVNMNVTFVKSVPMLLEENVVKMDFILSILPAVRQPQLYDLCGSTLNLIF
DLSVPYASAVIDDLLNIANIGNQCPPLRALKSQISRGFNCNVGEVLNMDTSDVPRCLHCP
AGTYVSEGQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIPVCGYGTYSP
TGLVPCLECPRNSFTAEPPTGGFKDCQACPAQSFTYQPAASNKDLCRAKCAPGTYSATGL
APCSPCPLHHYQGAAGAQSCNECPSNMRTDSPASKGREQCKPVVCGEGACQHGGLCVPMG
HDIQCFCPAGFSGRRCEQDIDECASQPCYNGGQCKDLPQGYRCECPAGYSGINCQEEASD
CGNDTCPARAMCKNEPGYKNVTCLCRSGYTGDQCDVTIDPCTANGNPCGNGASCQALEQG
RYKCECVPGWEGIHCEQNINDCSENPCLLGANCTDLVNDFQCACPPGFTGKRCEQKIDLC
LSEPCKHGTCVDRLFDHECVCHPGWTGSACDINIDDCENRPCANEGTCVDLVDGYSCNCE
PGYTGKNCQHTIDDCASNPCQHGATCVDQLDGFSCKCRPGYVGLSCEAEIDECLSDPCNP
VGTERCLDLDNKFECVCRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGGFECGCEPGWS
GMRCEQQVTTCGAQAPCQNDASCIDLFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGK
CQDFGSGLNCSCPADYSGIGCQYEYDACEEHVCQNGATCVDNGAGYSCQCPPGFTGRNCE
QDIVDCKDNSCPPGATCVDLTNGFYCQCPFNMTGDDCRKAIQVDYDLYFSDPSRSTAAQV
VPFPTGEANSLTVAMWVQFAQKDDRGIFFTLYGVQSARMTQQRRMLLQAHSSGVQVSLFE
DQPDAFLSFGEYTSVNDGQWHHVAVVWDGISGQLQLITEGLIASKMEYGAGGSLPGYLWA
VLGLPQPYGLSNELAYSDSGFQGTITKAQVWARALDITSEIQKQVRDCRSEPVLYPGLIL
NWAGYEVTSGGVERNVPSLCGQRKCPVGYTGANCQQLVVDKEPPVVEHCPGDLWVIAKNG
SAVVSWDEPHFSDNIGVTKIYERNGHRSGTTLLWGTYDITYIASDAAGNTASCSFKVSLL
TDFCPALADPVGGSQVCKDWGAGGQFKVCEIACNAGLRFSEPVPEFYTCGAEGFWRPTRE
PSMPLVYPSCSPSKPAQRVFRIKMLFPSDVLCNKAGQAVLRQKVTNSVNGLNRDWNFCSY
AIEGTRECKDIQIDVKCDHYRGTQNNRVRRQAKDGGVYVMEAELPVVNDDDDDLTLTGRQ
GRQQTGGDTYTLEIAFPAANDPVVHTSTGERSTVKQLLEKLILEDDQFAVQEILPNTVPD
PASLELGSEYACPVGQVVMIPDCVPCAIGTFYDSANKTCIACSRGTYQSEAGQLQCSKCP
VIAGRPGVTAGPGARSAADCKERCPAGKYFDAETGLCRSCGHGFYQPNEGSFSCELCGLG
QTTRSTEATSRKECRDECSSGQQLGADGRCEPCPRGTYRLQGVQPSCAACPLGRTTPKVG
ASSVEECTLPVCSAGTYLNATQNMCIECRKGYYQSESQQTSCLQCPPNHSTKITGATSKS
ECTNPCEHIAEGKPHCDVNAYCIMVPETSDFKCECKPGFNGTGMACTDVCDGFCENSGAC
VKDLKGTPSCRCVGSFTGPHCAERSEFAYIAGGIAGAVIFIIIIVLLIWMICVRSTKRRD
PKKMLTPAIDQTGSQVNFYYGAHTPYAESIAPSHHSTYAHYYDDEEDGWEMPNFYNETYM
KDGLHGGKMSTLARSNASLYGTKEDLYDRLKRHAYTGKKEKSDSDSEVQ
Download sequence
Identical sequences E1JHA6
NP_001162899.1.81976 NP_001245922.1.81976 NP_001245923.1.81976 NP_001245924.1.81976 FBpp0291372 FBpp0297915 FBpp0297916 FBpp0297917 FBpp0291372 FBpp0291372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]