SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0298337 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0298337
Domain Number 1 Region: 8-67
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000312
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0298337   Gene: FBgn0002283   Transcript: FBtr0307336
Sequence length 222
Comment pep:known chromosome:BDGP5:3L:16581657:16583232:1 gene:FBgn0002283 transcript:FBtr0307336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQ
SHPLQYISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMD
AHAESDFHRLDEQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYR
EIDILCNEELLGKDHTLKFVYVTRWRFRDPPLRLQFRPRVEL
Download sequence
Identical sequences A0A1W4UTP0 B4HJQ1 B4LB80 B4PKC7 B4QMV5 Q9VV77
NP_001246797.1.81976 NP_524933.1.81976 XP_002030792.1.34323 XP_002046302.1.90633 XP_002085162.1.80810 XP_002095113.1.41174 XP_016924424.1.48971 XP_016966064.1.21709 XP_016980739.1.97277 XP_017043062.1.74164 XP_017081004.1.81094 XP_017128699.1.32376 DS10_00010088 FBpp0213051 FBpp0075071 FBpp0227239 FBpp0207123 7227.FBpp0075071 7244.FBpp0227239 7245.FBpp0264874 FBpp0075071 FBpp0298337 FBpp0075071 FBpp0264874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]