SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300165 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300165
Domain Number 1 Region: 71-107
Classification Level Classification E-value
Superfamily SAP domain 0.00000421
Family SAP domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300165   Gene: FBgn0042185   Transcript: FBtr0307510
Sequence length 443
Comment pep:known chromosome:BDGP5:3L:6543838:6585249:1 gene:FBgn0042185 transcript:FBtr0307510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRNRAAMVSAFRLFLRPATTTTHRSLALRLAPGTTFALHLRPCHELQQHRSFASTAEDG
ETDKHKKPTTGDITRLTLAELRTRLKALGLSAAGRKQVLVERLTRSTTCSATTLPRTTGS
NLSPEVFIGGLVNNSNTTSEPKNTVQQNEDIYVEYVNGMPHMTVRLPSRNELCQFALKPI
SHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSIQINNRTLDVNPPK
RDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQLAKELETLRYELEPLEEKKLEL
SKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCV
TKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELEYNLRRINDPLNMQLPS
HLVRTQENTPPTLTEEKAERKYT
Download sequence
Identical sequences FBpp0300165 NP_996002.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]