SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300318 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300318
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.41e-17
Family SAM (sterile alpha motif) domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300318   Gene: FBgn0263117   Transcript: FBtr0307884
Sequence length 374
Comment pep:known chromosome:BDGP5:3R:18135203:18149816:-1 gene:FBgn0263117 transcript:FBtr0307884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHHNIVCEWLRTIGLAHYGESFLENGYDELEICKQIGEIDLDAIGVDNPSHRGKLLKSV
RMLREKGAAIVYVLINDPKALSSSNEILASDCDTPVTMKELEAVMKRHLEADGIRLTAHP
YSTPEGKRGYLEGLAAHYSKQINMPYDDVLDAIEQVRLSKWKERHVRISTGHTLSRRMAG
PSCSGTGLVSSSVMPTSHSQPLYVPGKYLPSSCLSNREENEIYSYTQNDLANRMARNAID
SKSALNLNGMQHSYPGARTNFFYNFSATEGRNKHKQRRTVFHRFLQGLRQSGDELNATEG
MQLKTNERLRNCSTMKRPEPHQDFEKTIQRLKTQKAAQKKPASAPMEMAIHDRNKEVAHT
HVNEMPLNNYTKHP
Download sequence
Identical sequences Q9VD37
NP_001247236.1.81976 NP_001287461.1.81976 NP_651018.2.81976 FBpp0111522 FBpp0300318 FBpp0111522 FBpp0111522 7227.FBpp0111522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]